KEGG   Medicago truncatula (barrel medic): MTR_2g099510Help
Entry
MTR_2g099510      CDS       T01716                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mtr00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 532 aa AA seqDB search
MASSTSLFQSSPFSLNTKTKPYSSLPKSPKPTHFIIKSQQQPHPVTQNNTPIPTPTPTPP
TTRRPADENIRDEARRKNVSQHLFSAKYVPFNADPSSTESYSLDEIVYRSQSGDLLDVQH
DLTALKKFDGAYWRNLFDSRVGKTTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFW
AERFGKQFLGMSDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMNRPVVGVGCASTGDT
SAALSAYCASAGIPSIVFLPANRISIAQLVQPIANGAFVLSIDTDFDGCMQLIREVTAEL
PIYLANSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFHMCRELGL
VDRIPRLVCAQAANANPLYLYFKSGWKEFKAVRAQTTFASAIQIGDPVSIDRAVHALKNC
NGIVEEATEEELMDAMAQADSTGMFTCPHTGVALTALFKLRNSGVIKPTDRTVVVSTAHG
LKFTQSKIDYHSKGIKDLACQFANPPTQVKADFGSVMDVLSKYLQSKAPKYH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaacatctctgttccaatcttcacctttctctctcaacaccaaaaccaaa
ccctattcttctcttcccaaatcaccaaaacccactcatttcatcatcaaatctcaacaa
caaccgcaccccgttactcaaaacaacacccccattcctactcccacacccactcctccc
accacccgtcgtcccgccgatgaaaacatccgcgacgaagcccgtcgcaaaaacgtctcc
caacatctcttctccgccaaatacgtccctttcaacgccgatccatcttccaccgaatcc
tactctctcgacgagatcgtctaccgttctcaatccggcgatcttctcgacgtgcagcac
gacctaaccgccttgaagaaattcgacggcgcttattggcgtaacctcttcgattcacgc
gtcggtaaaactacatggccttatgggtctggtgtttggagcaaaaaggaatgggttttg
cctgagatcgatgatgatgatattgttagtgcttttgaaggtaattctaatcttttttgg
gctgaacgttttggcaaacagtttctaggcatgagtgatttgtgggttaagcattgtggt
attagtcatactggtagttttaaggatctgggtatgactgtgcttgttagtcaagttaac
cgcttgcgaaaaatgaaccgtccagttgttggtgttggttgtgcttcgactggggatact
tcggctgctttgtcggcttattgtgcatcggcagggataccttcgattgttttcctgcct
gctaataggatttcaattgctcagttggttcaaccgattgcaaatggtgcttttgttctt
agcattgatactgattttgatgggtgtatgcagttgataagagaggtgactgctgaattg
ccgatttatttggcgaattcgcttaatagtttgaggcttgaaggacagaaaacagctgcc
attgagattttgcagcagtttgattggcaggtgccggattgggttattgtgccgggtggg
aatcttgggaatatttatgctttttataaagggtttcatatgtgtagagagttgggtctt
gtggataggattccaaggcttgtttgtgctcaggctgccaatgcgaatccgttgtatttg
tattttaagtcggggtggaaagagtttaaggcagtgagggcacaaactacttttgcatct
gctatacagatcggtgatccggtttctattgatagagctgttcatgctttgaagaactgc
aatgggattgttgaggaagctactgaggaggaattgatggatgctatggctcaagctgat
tcgacggggatgtttacttgtcctcacactggtgttgctttgactgctttgtttaaactc
aggaatagtggggttattaagcctactgataggactgtggtggtgagtactgctcatggt
ttgaagtttactcagtctaaaattgattaccattcaaagggtatcaaggatttggcttgc
caatttgccaatcctccaacgcaagtcaaggctgattttgggtctgttatggatgttttg
tccaagtatttgcagagcaaggctccaaagtatcattag

DBGET integrated database retrieval system