KEGG   Medicago truncatula (barrel medic): MTR_2g099510Help
Entry
MTR_2g099510      CDS       T01716                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTR_2g099510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTR_2g099510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MTR_2g099510
Enzymes [BR:mtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MTR_2g099510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 532 aa AA seqDB search
MASSTSLFQSSPFSLNTKTKPYSSLPKSPKPTHFIIKSQQQPHPVTQNNTPIPTPTPTPP
TTRRPADENIRDEARRKNVSQHLFSAKYVPFNADPSSTESYSLDEIVYRSQSGDLLDVQH
DLTALKKFDGAYWRNLFDSRVGKTTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFW
AERFGKQFLGMSDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMNRPVVGVGCASTGDT
SAALSAYCASAGIPSIVFLPANRISIAQLVQPIANGAFVLSIDTDFDGCMQLIREVTAEL
PIYLANSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFHMCRELGL
VDRIPRLVCAQAANANPLYLYFKSGWKEFKAVRAQTTFASAIQIGDPVSIDRAVHALKNC
NGIVEEATEEELMDAMAQADSTGMFTCPHTGVALTALFKLRNSGVIKPTDRTVVVSTAHG
LKFTQSKIDYHSKGIKDLACQFANPPTQVKADFGSVMDVLSKYLQSKAPKYH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaacatctctgttccaatcttcacctttctctctcaacaccaaaaccaaa
ccctattcttctcttcccaaatcaccaaaacccactcatttcatcatcaaatctcaacaa
caaccgcaccccgttactcaaaacaacacccccattcctactcccacacccactcctccc
accacccgtcgtcccgccgatgaaaacatccgcgacgaagcccgtcgcaaaaacgtctcc
caacatctcttctccgccaaatacgtccctttcaacgccgatccatcttccaccgaatcc
tactctctcgacgagatcgtctaccgttctcaatccggcgatcttctcgacgtgcagcac
gacctaaccgccttgaagaaattcgacggcgcttattggcgtaacctcttcgattcacgc
gtcggtaaaactacatggccttatgggtctggtgtttggagcaaaaaggaatgggttttg
cctgagatcgatgatgatgatattgttagtgcttttgaaggtaattctaatcttttttgg
gctgaacgttttggcaaacagtttctaggcatgagtgatttgtgggttaagcattgtggt
attagtcatactggtagttttaaggatctgggtatgactgtgcttgttagtcaagttaac
cgcttgcgaaaaatgaaccgtccagttgttggtgttggttgtgcttcgactggggatact
tcggctgctttgtcggcttattgtgcatcggcagggataccttcgattgttttcctgcct
gctaataggatttcaattgctcagttggttcaaccgattgcaaatggtgcttttgttctt
agcattgatactgattttgatgggtgtatgcagttgataagagaggtgactgctgaattg
ccgatttatttggcgaattcgcttaatagtttgaggcttgaaggacagaaaacagctgcc
attgagattttgcagcagtttgattggcaggtgccggattgggttattgtgccgggtggg
aatcttgggaatatttatgctttttataaagggtttcatatgtgtagagagttgggtctt
gtggataggattccaaggcttgtttgtgctcaggctgccaatgcgaatccgttgtatttg
tattttaagtcggggtggaaagagtttaaggcagtgagggcacaaactacttttgcatct
gctatacagatcggtgatccggtttctattgatagagctgttcatgctttgaagaactgc
aatgggattgttgaggaagctactgaggaggaattgatggatgctatggctcaagctgat
tcgacggggatgtttacttgtcctcacactggtgttgctttgactgctttgtttaaactc
aggaatagtggggttattaagcctactgataggactgtggtggtgagtactgctcatggt
ttgaagtttactcagtctaaaattgattaccattcaaagggtatcaaggatttggcttgc
caatttgccaatcctccaacgcaagtcaaggctgattttgggtctgttatggatgttttg
tccaagtatttgcagagcaaggctccaaagtatcattag

DBGET integrated database retrieval system