KEGG   Medicago truncatula (barrel medic): MTR_2g099510Help
Entry
MTR_2g099510      CDS       T01716                                 

Definition
(RefSeq) threonine synthase-like protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00260  Glycine, serine and threonine metabolism
mtr00750  Vitamin B6 metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01230  Biosynthesis of amino acids
Module
mtr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTR_2g099510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MTR_2g099510
Enzymes [BR:mtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MTR_2g099510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 11423271
NCBI-ProteinID: XP_003597553
UniProt: G7IS24
Position
2
AA seq 532 aa AA seqDB search
MASSTSLFQSSPFSLNTKTKPYSSLPKSPKPTHFIIKSQQQPHPVTQNNTPIPTPTPTPP
TTRRPADENIRDEARRKNVSQHLFSAKYVPFNADPSSTESYSLDEIVYRSQSGDLLDVQH
DLTALKKFDGAYWRNLFDSRVGKTTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFW
AERFGKQFLGMSDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMNRPVVGVGCASTGDT
SAALSAYCASAGIPSIVFLPANRISIAQLVQPIANGAFVLSIDTDFDGCMQLIREVTAEL
PIYLANSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFHMCRELGL
VDRIPRLVCAQAANANPLYLYFKSGWKEFKAVRAQTTFASAIQIGDPVSIDRAVHALKNC
NGIVEEATEEELMDAMAQADSTGMFTCPHTGVALTALFKLRNSGVIKPTDRTVVVSTAHG
LKFTQSKIDYHSKGIKDLACQFANPPTQVKADFGSVMDVLSKYLQSKAPKYH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaacatctctgttccaatcttcacctttctctctcaacaccaaaaccaaa
ccctattcttctcttcccaaatcaccaaaacccactcatttcatcatcaaatctcaacaa
caaccgcaccccgttactcaaaacaacacccccattcctactcccacacccactcctccc
accacccgtcgtcccgccgatgaaaacatccgcgacgaagcccgtcgcaaaaacgtctcc
caacatctcttctccgccaaatacgtccctttcaacgccgatccatcttccaccgaatcc
tactctctcgacgagatcgtctaccgttctcaatccggcgatcttctcgacgtgcagcac
gacctaaccgccttgaagaaattcgacggcgcttattggcgtaacctcttcgattcacgc
gtcggtaaaactacatggccttatgggtctggtgtttggagcaaaaaggaatgggttttg
cctgagatcgatgatgatgatattgttagtgcttttgaaggtaattctaatcttttttgg
gctgaacgttttggcaaacagtttctaggcatgagtgatttgtgggttaagcattgtggt
attagtcatactggtagttttaaggatctgggtatgactgtgcttgttagtcaagttaac
cgcttgcgaaaaatgaaccgtccagttgttggtgttggttgtgcttcgactggggatact
tcggctgctttgtcggcttattgtgcatcggcagggataccttcgattgttttcctgcct
gctaataggatttcaattgctcagttggttcaaccgattgcaaatggtgcttttgttctt
agcattgatactgattttgatgggtgtatgcagttgataagagaggtgactgctgaattg
ccgatttatttggcgaattcgcttaatagtttgaggcttgaaggacagaaaacagctgcc
attgagattttgcagcagtttgattggcaggtgccggattgggttattgtgccgggtggg
aatcttgggaatatttatgctttttataaagggtttcatatgtgtagagagttgggtctt
gtggataggattccaaggcttgtttgtgctcaggctgccaatgcgaatccgttgtatttg
tattttaagtcggggtggaaagagtttaaggcagtgagggcacaaactacttttgcatct
gctatacagatcggtgatccggtttctattgatagagctgttcatgctttgaagaactgc
aatgggattgttgaggaagctactgaggaggaattgatggatgctatggctcaagctgat
tcgacggggatgtttacttgtcctcacactggtgttgctttgactgctttgtttaaactc
aggaatagtggggttattaagcctactgataggactgtggtggtgagtactgctcatggt
ttgaagtttactcagtctaaaattgattaccattcaaagggtatcaaggatttggcttgc
caatttgccaatcctccaacgcaagtcaaggctgattttgggtctgttatggatgttttg
tccaagtatttgcagagcaaggctccaaagtatcattag

DBGET integrated database retrieval system