KEGG   Medicago truncatula (barrel medic): MTR_2g099950Help
Entry
MTR_2g099950      CDS       T01716                                 

Definition
(RefSeq) cell-wall invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00052  Galactose metabolism
mtr00500  Starch and sucrose metabolism
mtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MTR_2g099950
   00500 Starch and sucrose metabolism
    MTR_2g099950
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MTR_2g099950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 11441979
NCBI-ProteinID: XP_003597593
UniProt: Q2HVE4
Position
2
AA seq 572 aa AA seqDB search
MAISPILLIALFSLIYGNYVIPIEATHHVYRTLESSSSYSSHHDQPYRTAYHFQPLKNWI
NGPMRYGGLYHLFYQYNPKGAVWGNIVWAHSASKDLVNWTPLDHAIHPSQPSDIKGCWSG
SATILPGGKPAILYTGIDPNNHQVQNIAIPKNMSDPLLREWKKSPKNPLMEPTVANKINA
SSFRDPTTSWLGKDGYWRVLIGSKVHRKGIAIMYKSKNFVDWFEAKHPLHSAEGTGMWEC
PDFFPVLNKNPLTIGLDTSVNGDDVRHVLKVSLDDTKHDHYLIGTYDTVKDVFVPDNGFE
NNQNVLRYDYGKYYASKTFFDDGKNRRILLGWANESSSVVDDVKKGWSGIHTIPRVIWLH
KSGKQLVQWPVKELENLRMNPVNWPTKVIKGGELIPITGVNSVQADVEISFEVKDFGKAE
LLDKWIDPQILCSQKGASVKGGVGPFGLHVFASKGLQEYTAVFFRIFRYQHKNLVLMCSD
QSRSSLNKENDMTTYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAI
HDKALLYAFNNGNSAVKITRLNAWSMKKAKIN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctatctctccaattttattgatagctctcttctctcttatttatggcaattatgtt
attcccattgaagctacccaccatgtttaccgaactcttgagagttcatcttcttattcc
tcacatcatgatcaaccttatagaactgcctatcacttccaacctctcaagaattggatc
aacggaccaatgagatatggaggactttatcatctgttctaccaatacaatccaaaaggt
gctgtttggggaaatattgtgtgggcccattcagcatcaaaggatcttgtgaattggaca
ccattggatcatgcaatccacccatctcaaccgtcagatataaaaggttgttggtcaggc
tcagcaacaatacttccaggtggcaaaccagcaattttatacacaggaattgatccaaat
aatcatcaagttcaaaacatagccatacccaaaaatatgtctgacccattacttagagaa
tggaaaaaatcaccaaaaaatccattgatggaacctactgttgctaacaaaattaatgca
agttcatttagggacccaactacttcttggctaggaaaagatggttattggagggtatta
attggaagcaaagtacatagaaagggaattgcaattatgtacaaaagtaaaaattttgtt
gattggtttgaagccaaacatcctttacattcagctgaaggaacaggaatgtgggagtgt
cctgatttttttccagtattaaataagaatccattaaccattggtcttgatacatctgtg
aatggtgatgatgttagacatgtgcttaaggttagtttggatgacacaaaacatgatcac
tatttgattgggacttatgatactgttaaggatgtctttgttccagataatggctttgag
aataatcaaaatgtgttgagatatgattatgggaaatattatgcatcaaaaacatttttt
gatgatgggaagaatagaaggatcttgttgggttgggctaatgaatcttcaagtgttgtt
gatgatgtcaagaaaggatggtctggaatccatactattccaagggttatctggcttcat
aaatcagggaaacagttggtgcaatggccagtgaaagaacttgaaaatctacgtatgaac
ccagtcaattggccaaccaaggtgatcaagggaggtgaattgattccaattactggtgtt
aattcagtacaggctgatgttgaaatttcatttgaagtgaaagattttggaaaggccgaa
ttattggacaaatggatagatcctcaaattttgtgtagtcaaaagggtgcatcagtaaaa
ggtggtgttggaccatttggtctgcatgtgtttgcttctaaaggcttgcaagagtacaca
gcagtgttttttagaatattcagatatcaacataagaatttggttctcatgtgcagtgac
caaagcaggtcatctttgaataaagagaatgatatgaccacatatgggacttttgtggat
gttgacccacttcatgaaaagctgtcactaagaactttgattgaccattcagtggtggag
agttttggtggagaaggaagggcctgcatcacagctagagtttatcctacattagcaatc
catgataaggctttgttatatgctttcaataatggaaattctgcagtcaagatcacaaga
ttgaatgcttggagcatgaagaaagcaaaaatcaactaa

DBGET integrated database retrieval system