KEGG   Medicago truncatula (barrel medic): MTR_2g101880Help
Entry
MTR_2g101880      CDS       T01716                                 

Definition
Protein disulfide isomerase L-3b
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mtr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 520 aa AA seqDB search
MSKSINFLLTLFLLLSFNHVVTQCSEVDEFDELLALDDELEREKEHDGVKSSEAEVLTKA
QRIVHELNNENTERIVNGYEFVLVLGYAPWCSRSAELMPHFAEAANSLKEFGNSLVLAKL
DGDRFTKAASFLGIKGYPTLLLFVNGTSQPYSGGFTADDIVIWARKRTGTPVIRISTEKA
AEEFLKKYHTFLIGRFDKFEGPEYEEFVSAAKSDNETQFVDVSKVELAQVLYPDIKPTGN
FLGIVKSEPERYTAYDGAFRLDKIMEFLSYNKFPLVTQLTEMNSVSVYSSPAKHQVFVFA
NTDDFKNLLDSLQEVARTFKSKIMFIYVDINDENLAKPFLTMFGLEESTNTVVAAFDNGM
SSKFLLESKPTRSNIEEFCSKLVQGSLLTYFKSQPIPDNTEAIVQVVVGKTFDEEILNSK
KDVVLEVFTPWCFNCEDTSKQVEKLAKHYKSSSNLIFARIDASANEHPKLQVNDFPTLLL
YKANDKTNPIKLSTKSSLKELAASINKHVKVKDQVAKDEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatccatcaatttccttctaacccttttcttattactcagtttcaaccacgtt
gttacacaatgttccgaagttgatgaatttgatgaactattagcattagacgatgaatta
gagcgagaaaaggaacatgatggtgtgaaatcatctgaagcagaggttttaaccaaagca
caaaggattgttcatgaactcaataatgaaaacacagagagaattgttaatgggtatgag
tttgttcttgttcttggttatgcaccttggtgttcaagaagtgctgaacttatgcctcat
tttgctgaagctgctaattctttgaaagagtttggaaattctcttgttttggctaagttg
gatggtgataggtttactaaagctgcttcttttcttgggattaaaggctaccctactttg
cttctttttgttaatgggacttctcaaccttattctggcggtttcacggcggatgatata
gttatatgggcaagaaaaaggaccggtacacctgttattcggataagtacagagaaagca
gcagaggaatttctgaaaaagtatcacacttttctcattggccgctttgataaatttgag
ggccctgaatatgaagaatttgtgagtgctgcaaagtccgataatgaaacccagttcgtt
gatgtgagtaaggtagagcttgcccaagttctttatccagatatcaagcctactggtaat
tttctcgggatcgttaagagcgaacctgaaagatatacagcttatgatggagctttcagg
ttggataaaataatggagtttttaagctacaacaaatttccgttagttacacaactcact
gaaatgaattctgtcagtgtctactcaagcccagccaagcatcaggtttttgtctttgcg
aacactgatgacttcaagaatcttcttgattcacttcaagaagtagcaagaacattcaag
tcgaagataatgtttatatatgtggatattaacgacgagaaccttgcaaagcccttcctg
acaatgtttggacttgaagaatcaacaaatactgtggtagctgcatttgataatggaatg
agctcaaaatttctattggagtcaaaaccaacacgaagcaatattgaagagttctgcagt
aaacttgtgcaaggttctttgctgacttacttcaagtcgcagccaataccagataatact
gaagctattgtccaagttgttgttgggaaaacatttgacgaagaaattttgaacagcaag
aaggatgtggttttagaggtattcacaccttggtgtttcaactgtgaggacacaagcaag
caagtagagaagttggcaaagcactacaaaagttcaagcaatctaatatttgcaaggata
gatgcttcagcaaatgaacatccaaaactgcaagtgaatgattttcccacacttttactt
tacaaagcaaatgataagacaaatccgatcaagctttctacgaaatctagtttgaaagaa
ttggctgcatccatcaacaaacacgttaaagtcaaggatcaagtcgccaaagatgagcta
tag

DBGET integrated database retrieval system