KEGG   Medicago truncatula (barrel medic): MTR_2g103140Help
Entry
MTR_2g103140      CDS       T01716                                 

Definition
Acyl-protein thioesterase
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MTR_2g103140
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MTR_2g103140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 257 aa AA seqDB search
MSHAHSHIGSGSRTTRRTFEFGKTHVVRPKGKHQATIVWLHGLGDNGLSSSQLLESLPLP
NIKWICPTAPTRPVAILGGFPCTAWFDVGELSEDGPDDWEGLDASAAHIANLLSTEPADV
KVGIGGFSMGAAIALYSATCYAMGRYGNGIPYPVNLRAVVGLSGWLPGSRSLGNKIEVSH
EARRRAASLPILQCHGISDDVVHCKYGEKSAQSLSSAGFRYVAFKSYEGIGHYTVPREMG
EVSTWLSSRLGLEGFSS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgcgcattctcatatcggctccggtagtagaactactcgacgaacttttgaa
ttcgggaagacacatgtagtgaggcctaaaggaaaacatcaagctactatagtttggttg
catggacttggtgataatggtttgagctcatctcagttgttggaatcacttccacttcca
aatataaaatggatttgccctactgctcctacccgtcccgtggcgatacttggtggtttt
ccctgcactgcatggtttgatgtgggagagctttcggaagatggtccagatgattgggag
ggtttagatgcttcagcagcacatattgctaacttgttgtcaacagagccagcagatgtg
aaagttggtattggagggttcagcatgggtgcagcaatagcattatactctgcaacatgc
tatgccatgggaaggtatggaaatggcatcccatatcctgtcaatttaagagcagttgtt
ggactcagtggttggcttccaggatcaaggagcttagggaacaagatagaagtgtcacat
gaagcgagaaggcgagctgcttcattaccaattttacagtgtcacggaatcagtgatgat
gtagtccactgtaagtatggagagaaatctgctcaatccttaagttcagcagggtttcga
tatgttgcattcaaatcctatgaagggattggtcattacacagttccaagagagatgggt
gaagtttccacctggcttagttcaaggttgggacttgaaggattttcgtcgtaa

DBGET integrated database retrieval system