KEGG   Medicago truncatula (barrel medic): MTR_2g104100Help
Entry
MTR_2g104100      CDS       T01716                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MTR_2g104100
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MTR_2g104100
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MTR_2g104100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 424 aa AA seqDB search
MPELPEVEAARRAVEENCIGKKITKCIVADDNKVIDGVSREEFEASVVGKKIVAARRKGK
NMWLQLDSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVNDEDEWPSKYSKFFIQLDDGLEL
SFTDKRRFARVRLLKDPTSVPPISELGPDALFDFMTLDEFTERLHKKKTEIKALLLDQSY
ISGIGNWVADEVLYQARIHPRQIASSLSGESCSTLYKCIKEVIQFAVEVDADCSRFPLEW
LFHFRWGKKPGKISVEVGADSSQYPTNWIFHSREKKPGKAFVDGKTIEFITAGGRTTAYV
PELQKLSGSQVLKETGKLRGKASKKSSVDDDNNDGADENLESLKSKKGTKAGAKAKKPSK
RKKTEESDDDNDGDAGTDNYDDSDQVEKKKPGSGTNRKQAKGEKQSKKSVQGNQSSRSTR
SKAK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctaccggaggtagaggcggcgagaagagcggtggaagagaactgtatcgga
aagaagataaccaaatgcatcgtcgccgatgataacaaagtcatcgacggtgtctctcgc
gaagagttcgaagcttccgttgttgggaagaagattgttgcagctcgccggaaggggaag
aatatgtggcttcagcttgattctcctccttttccttcctttcaattcggtatggctggt
gctgtatacatcaagggtgttgctgtaacaaagtataaaaggtctgctgtaaatgacgag
gatgaatggccttccaagtattcaaagttttttattcagctagacgatggtttggagctg
tctttcaccgacaaaaggcgatttgctagagttcgcctgctcaaagatccgacatcagtg
cctcccatatctgagcttggacctgatgcactttttgatttcatgacacttgatgagttt
actgagcgtttgcacaagaagaaaactgaaatcaaggctttattactagatcaaagctat
atttcaggcattggaaattgggttgcagatgaagtgctgtaccaagcaaggattcatcca
cggcagatagcttctagcctatcaggagaaagctgctcaactttatataagtgcattaaa
gaggttattcaatttgcggttgaagttgatgctgactgtagccgttttccccttgagtgg
ttatttcattttcgatgggggaaaaagcctggaaaaataagtgttgaagttggggcagat
agtagtcaatatcccactaattggatatttcattcccgtgaaaagaagcccggcaaagct
tttgttgatgggaaaacgattgagttcatcactgcaggtggcaggacaactgcttacgtg
ccagagttgcaaaagctaagtggatcacaagtgctaaaagaaactggcaagctcagaggg
aaagcctcaaagaaatcaagtgtagatgatgataacaatgacggcgctgacgagaatttg
gaaagtctcaaatcaaagaaggggacgaaggcaggagctaaagctaagaaaccttcaaaa
agaaaaaagaccgaggaaagtgacgatgacaatgatggtgatgctggtactgataattat
gatgatagcgatcaagttgaaaagaagaaaccaggctcggggactaataggaaacaagct
aagggagagaagcaatcaaagaaaagtgttcaaggcaatcaaagtagtagaagtactagg
agtaaagctaagtag

DBGET integrated database retrieval system