KEGG   Medicago truncatula (barrel medic): MTR_3g007710Help
Entry
MTR_3g007710      CDS       T01716                                 

Definition
Histone acetyltransferase
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MTR_3g007710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 464 aa AA seqDB search
MGSLDAPISAENGTAPAAGHGKSPLTDGGMRPPPSDSVPEYELVKRRRSSVLPLEVGTRV
MCRWRDGKYHPVKVIERRRVHGCGPNDYEYYVHYTEFNRRLDEWVKLDQLDLESVEAVVD
EKVEEKGASGLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIE
TWYFSPFPSEYNDCLKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFE
VDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDERGCHMVGYFSKQEFIHY
LFDIMDNLIDIDCFFIVKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKV
GTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELI
QYRKGQHVICADPKVLDRHLKAAGRGGLDVDVSKLIWTPYKEQS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgctcgacgcaccaatcagcgcggaaaacggcaccgctccggccgccggtcac
ggcaaatcgccgttaaccgatggtggcatgcgccctccgccgtcagattcggtaccggag
tacgaattggtgaagcggcggagatcttctgtgcttccgttggaggttgggacgcgcgtg
atgtgccgttggagagatggaaagtatcatcctgtcaaagtcatcgaacgaaggagagtc
catggctgtggacctaatgattatgagtattacgtccattatactgagttcaataggagg
cttgatgagtgggtgaaacttgaccagcttgatcttgaatctgtggaggcagttgttgat
gagaaagtggaggagaagggggcatcaggtttgaagatgacacgtcaccaaaagaggaag
atcgatgagacacatgtagagggccatgaagagcttgatgctgctagtttacgagaacat
gaggagtttacaaaagtgaaaaatatagctactattgaacttggaagatatgagatcgag
acatggtacttctccccatttccatcagaatacaatgactgtttgaagctgttcttttgt
gagttttgcctcaatttcatgaagcgcaaagagcagcttcagaggcatatgaaaaaatgt
gatcttaagcatccccctggtgatgagatatacagaagtggtacattgtcaatgtttgag
gttgatggcaagaagaacaaggtttatgggcagaatctttgttatttggccaagttgttt
cttgatcacaagaccctctactatgatgttgacctgtttctgttctatgttttgtgtgaa
tgtgatgaaagaggatgccacatggttggatatttttcgaagcaggaatttattcattat
ttgtttgacattatggacaaccttattgatattgattgcttttttatcgtaaaggaaaaa
cattccgaggaatcctacaatttggcatgtatcctcaccctcccaccttaccaaaggaaa
ggctatggaaaatttctaattgctttctcatatgaactttcgaagaaggagggaaaagtt
ggtacacctgaaaggcccctttcagaccttggactgctaagctacagaggatattggacc
agggttcttttagacattctgaaaaagcataagggaaacatttctatcaaggagctgagt
gatatgactgccattaaagctgaagatatattgacaactctacagagcctagaactgatt
caatacaggaaaggacagcatgtcatttgtgcggatccaaaagttttggatcgccatctt
aaagcggctggcagagggggtcttgacgttgatgttagcaaattgatttggacaccttat
aaagaacaaagttga

DBGET integrated database retrieval system