KEGG   Medicago truncatula (barrel medic): MTR_3g008640Help
Entry
MTR_3g008640      CDS       T01716                                 

Definition
Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mtr00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 527 aa AA seqDB search
MAIIGKTLFMLFFLSSIFSIASSRKGPSSSNIDWWCNLTPHPKPCKHYTTQMNNHFKIKH
RVEFREMLVQLALKQALTMQKEAQENSQQQQNSFVHKTVHGDCLKLFENTIFHLNRTLEG
LNNASKNCSPNDAQTWLTTSLTNIETCKSGALELNAQDFDFIMQTNVTEMIRNILAINMH
FLKHSKETEEGSFPNWFSVHERKLLQSKGPVKYNLVVAKDGSGQYKTVQAALNAAAKRKY
KTRFVIHVKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDG
LHFIARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIY
GTVDFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNTGISFHNCQIRAASDLK
PVVDKYKTFLGRPWQQYSRVMVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENYGPG
SSTANRVKWPGYHVISNPNEASKFTVAGLLAGPTWLATTTVPFTSGL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcattggaaaaacattgtttatgctctttttcttatcatcaattttctcaata
gcctcatcaagaaaaggaccttcctcaagcaacatagattggtggtgcaatttaacacca
catccaaagccatgcaaacactacacaacacaaatgaacaatcatttcaaaatcaaacat
agagttgaattcagggaaatgcttgttcaattagccttaaaacaagctcttaccatgcaa
aaagaagcacaagaaaattctcaacaacaacaaaactcatttgtgcataaaacggttcat
ggtgattgtttgaagctatttgaaaacacaatttttcatctcaaccgtacacttgaaggc
ttaaacaatgctagcaaaaattgttcaccaaatgatgcacaaacatggctaacaacttct
ctcacaaatattgaaacatgtaaaagtggagctttagaactcaatgctcaagatttcgat
ttcattatgcaaaccaatgtcactgaaatgataaggaacatcttagccatcaatatgcat
ttcctgaaacatagcaaagaaacagaagaagggtcatttccaaattggttttctgtgcat
gaaaggaagcttttgcagtcaaagggtccagtaaagtacaatcttgtggtggcaaaagat
ggttctggacagtacaagactgtgcaggctgctttaaatgctgctgctaagagaaaatat
aagacaaggtttgtgatacatgttaagaaaggtgtttatagagagaacattgaggttgct
gttcataatgacaatattatgctggttggtgatgggatgcaaaataccataataacaagt
tctagaagtgttcaaggtggttttaccacttatagctctgcaacagcaggtattgatgga
cttcacttcattgcacgtgacataaccttccaaaataccgccggtccacacaagggtcaa
gcagtggcgctaagatcagcctccgatctctcagttttctatcggtgtgccatatcaggt
tatcaagacactctgatggctcatgcacaacgtcaattttatcgacaatgcttcatctat
ggcaccgtagacttcatctttggcaatgccgcagtggttttccaaaattgtaacattttc
gcaagaaaacctttagatggtcaagctaacatgatcacagcccaaggtcgaggtgaccca
ttccaaaacactggaatttcattccacaattgtcaaattagggctgcatcagatctaaag
cctgttgttgacaagtacaaaaccttcttgggcaggccttggcaacaatattcaagagtt
atggtgatgaaaactttcatggacactttagtaagccccctgggttggtctccatggggt
gacactgattttgctcaagacacattgtattatggagagtatgagaattatggacctggt
tcatcaacagcaaatagagtaaaatggcctggttatcatgtgatatcaaaccctaatgaa
gcatcaaagtttacggttgctggactccttgctggaccaacatggttggctacaactact
gtgccatttacatctggtctttga

DBGET integrated database retrieval system