KEGG   Medicago truncatula (barrel medic): MTR_3g013430Help
Entry
MTR_3g013430      CDS       T01716                                 

Definition
Choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mtr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 500 aa AA seqDB search
MGAGEDLANNAASVAENPVNQATPTTENPISNQAGGAENPVNVAKDQAVGAENPVNDTLG
GSDVLVNDKAHAAENSINDTAGDDGKESAMKDKAGEDDKQGAAENLAEEKPDAIETPVSS
KADRLPEEAKEILISLAGKWEDVLDANALQVIPLKGAMTNEVFEIKWPATTEETSRKVLV
RIYGEGVEIFFDRDDEIRTFEYMSKNGQGPRLLGRFTNGRVEEFIHARTLSASDLRDPSI
SALIAAKMKEFHDLDMPGEKKANLWPTLRNWLSEAKRLSSPKEVEAFYLDTVDKEISILE
KELSGSHQRIGFCHNDLQYGNIMLDEETNSVTIIDYEYASHNPVAYDIANHFCEMAANYH
TETPHILDYSKYPDVEERERFVKAYLRTSGEEPSDSEVEHLLQEVEKYTLANHLFWGLWG
IISGQVNTIEFDYKEYAKQRFQEYWARKPYLLSSDAPSPFNTPEGTGELASAAHPKGSKN
SGIFRKMKRVLGLGLFRSKT
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaggtgaagatcttgcaaacaatgcagctagtgttgccgagaatcctgtaaac
caggccactcctactacagaaaatcctataagcaatcaagcaggtggggcagaaaatcct
gtaaatgttgcaaaagaccaagcagttggtgcagaaaaccccgtaaatgacactttaggt
ggttcggatgttttagtgaatgataaagcacatgctgccgaaaattctataaatgataca
gcaggtgatgatggaaaagaaagtgctatgaaagacaaagcaggtgaagatgacaaacaa
ggtgctgcagaaaatctcgcagaagagaaaccagatgccatagaaacccctgtaagcagc
aaagctgaccgccttccagaagaagcaaaggagattctgatatcattagcaggtaaatgg
gaggatgtactagatgcaaatgcgttacaggtgatccctctcaagggggcaatgacaaat
gaggtatttgaaataaagtggccagctacaactgaggaaacctcacgaaaagttcttgtt
aggatctacggggagggtgtggaaattttctttgatagggatgatgaaatacggacattt
gagtacatgtcaaagaatggtcagggaccacgtctactaggacgttttacaaatggacgt
gttgaagagtttatccatgcacggacgctgtcagcttctgatctacgtgatccttccatt
tctgctcttatagcggccaaaatgaaggagttccatgatctagatatgcctggtgaaaag
aaagccaatctttggcctacattgagaaattggcttagtgaggccaaacgtttgtcttct
ccaaaagaagtcgaagctttttatttggacacggtcgacaaggaaatctctattttggaa
aaggagctgtcaggctcgcatcaacggatagggttttgccacaatgatttgcaatatggt
aacataatgcttgacgaagagaccaactctgtgaccataatagactatgaatatgctagt
cacaatcctgtagcgtatgatatagcaaaccacttctgtgagatggctgcaaactaccat
acagaaacgcctcatattcttgattatagcaaatatcctgacgttgaggagcgtgaaaga
tttgttaaggcgtatttgaggacctcaggtgaagaaccaagtgacagtgaagtggagcac
ttactacaagaagttgagaagtatacacttgcaaatcatctattctggggcctttgggga
ataatttcgggacaagtaaatacaattgaatttgactacaaggagtatgcgaaacagagg
tttcaagagtattgggcaaggaaaccttatcttctaagctctgatgcaccttctcctttt
aatacccctgagggtacaggagagcttgcatccgcagcgcaccccaaaggatcaaagaac
tctggtatcttcaggaagatgaagagagttttgggtcttggcttgttcaggtcaaaaacc
taa

DBGET integrated database retrieval system