KEGG   Medicago truncatula (barrel medic): MTR_3g051120Help
Entry
MTR_3g051120      CDS       T01716                                 

Definition
Tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mtr00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 412 aa AA seqDB search
MENHNNNDTGSVQSQRPDSFGRFGRFGGKYVPETLIHALTELEAAFHSLASDEDFQKELA
GVLKDYVGRESPLYFAERLTEHYKRGNGEGPHVYLKREDLNHTGAHKINNAVAQALLAKK
LGKKRVIAETGAGQHGVATATVCARFGLECVVYMGALDMERQALNVFRMRLLGAEVRAVH
AGTATLKDATSEAIRDWVTNVETTHYILGSVCGPHPYPMMVREFHAVIGKETRKQALEKW
GGKPDILVACVGGGSNAIGLFHEFIDDKDVRLIGVEASGLGLESGKHAATLTKGEVGVLH
GAMSYLLQDDDGQIIEPHSISAGLDYPGVGPEHSFLKDAGRAEYYSVTDEEALEAFKRVS
QLEGIIPALETSHALAYLEKLCPTLPNGTKVVVNCSGRGDKDVQTAMKYLKI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccataacaacaacgacaccggttcggttcaatctcagcgacccgattcattt
ggtcggtttgggcggtttggaggcaagtatgtccctgaaactctcatccatgctctcact
gagttagaagctgcattccattctctagcttccgatgaagattttcagaaagagctggct
ggggttctaaaggactatgtaggtagggagagccctctttactttgctgagaggctgaca
gagcactacaagcgtggtaacggtgaagggccacacgtgtatcttaagagagaggatctc
aaccacactggtgctcacaagattaataacgctgttgctcaggctttgcttgccaaaaag
ttggggaagaagagggttattgctgagactggtgctggccagcatggagttgccaccgcc
accgtgtgcgctcgatttgggttggaatgcgttgtttatatgggtgcactagatatggaa
agacaggcccttaatgtgttcagaatgcgccttcttggtgctgaggtgagagctgtacat
gcaggaactgctacgctgaaagacgctacatcggaagctataagggattgggtgactaat
gtggagactacacattacattttgggttcggtttgtgggccacatccatatcctatgatg
gtaagagagtttcatgcagtgatagggaaagaaacaagaaagcaagcattggaaaaatgg
ggagggaagccagatattctagtagcatgtgttggcggtggttcaaatgccattggtctt
ttccatgaatttattgatgacaaagatgttaggttgattggagtggaggcttctgggtta
ggccttgaaagtggcaagcacgccgctacattaacgaagggagaagttggagttttgcat
ggagcaatgagctatcttttgcaggatgatgatgggcaaataattgaacctcattctatc
agtgcagggttggactatccaggggttggaccagagcatagtttcttgaaagatgcaggg
cgtgctgaatactacagtgttacagacgaagaagcactcgaagcttttaaaagagtatcc
cagttggaaggcataattccagctttggaaacatcacatgctcttgcttatttagagaaa
ctctgccctacccttccaaatggaactaaggttgtggttaactgcagtggcagaggggat
aaggatgttcaaactgctatgaaatacttgaaaatttga

DBGET integrated database retrieval system