KEGG   Medicago truncatula (barrel medic): MTR_3g070710Help
Entry
MTR_3g070710      CDS       T01716                                 

Definition
Phosphoinositide phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mtr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mtr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 592 aa AA seqDB search
MKTKIFKIVVKFLTKKGKVDKEEPLFDLKEAFSKFANGENHMSKEQLLRFMVEYQGEQNC
TLLDLEPIIEKVLKMESSNTETSSIVGLSLDDFINFLLVDDFNGPLKDEVHHDMEAPLSH
YFMYTGHNSYLTGNQFTSESSDKPIIEALKQGVRVIELDLWPSSTKDGGIKVVHGKTLTT
PVALTKCLEAIKEYAFVKSDFPVILTLEDHLTPKLQYNFAKIAIQIFGNMLYRPGTDCLT
EFPSPASLKNMVLISTKSPKEYNQSDSVSNQVLNGCESSEDESWELQDSMVKLKTEEKSV
NDEDKEDINTNAFKSNQQVALQYKHLIAIHGGKSEGNMKDILKVDGGKVRRLSLSEKKLK
TASKSHGPDLIRFTQKNILRIYPKGERVRSSNFRPLLGWMYGAQMVACNMQGHGKPLRLM
QGMFKANGGCGYVKKPEFLIQEVANNEAFDPKRKLPAKQILKVKVYKGVGWSSDFSPTHF
DRFSPPDFYTKVSIAGVRADCAKKKTSVKMDNWNPIWDEEFEFRLTVPELALLRIEVKDK
DQTKDDFAGQTCLPVSELRHGFRSVALCDRKGKKYNSVKLLLGFQLETLKML
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaagatcttcaagatagtagtaaaatttttgaccaaaaaaggtaaagttgat
aaggaagagccgctttttgatcttaaggaagctttttccaagtttgcaaatggtgagaat
cacatgtcaaaggaacaactacttagattcatggtggagtatcaaggagagcaaaattgc
accttattggatttggagccaatcattgaaaaggttttgaaaatggaaagttctaacact
gaaactagcagtattgttggactcagtttggatgacttcataaattttctgcttgttgat
gatttcaatggtcccttaaaagatgaggtacatcatgatatggaagctcctttgtcacat
tatttcatgtatacaggacacaattcctaccttactggaaatcaatttactagtgagagc
agtgataaaccaattatagaggctttgaaacaaggtgtacgagtaattgaacttgattta
tggccatcttcaactaaagatggtggtattaaagtagttcatggaaagactctcaccact
ccagttgcactaaccaaatgtttggaagccataaaagaatatgcttttgttaaatctgat
tttccagtgattctaactttagaagaccacctaacaccaaagcttcagtataactttgca
aaaatagcaattcaaatatttggaaatatgctttatcgtcctgggacagattgtttaaca
gaatttccctcgccagcatcactcaaaaatatggtacttatatcaactaaatcaccaaaa
gaatataatcaatctgatagtgtcagcaatcaggtgttaaatggatgtgaatcatctgaa
gacgaatcatgggaattgcaagattctatggttaaactgaaaactgaagaaaagagtgta
aatgatgaagacaaggaagatataaatacaaatgctttcaaatcaaaccagcaagttgca
cttcaatacaaacatttgattgcaattcatggtggaaaatcagaaggtaacatgaaggat
atactaaaagttgatggtggtaaagtcagaaggctaagtttgagtgagaagaaactcaaa
actgcttctaaatctcatgggcctgacctaattaggttcacacagaaaaatatcctcaga
atttatcctaaaggagaacgtgtccgatcctcaaattttaggccacttttagggtggatg
tatggagctcagatggttgcatgcaatatgcaggggcatggcaaaccactccggttgatg
caagggatgttcaaagcgaatggagggtgtggttatgtgaaaaaacctgaatttctaatt
caagaagttgcaaataatgaggcttttgatcctaaaagaaagttgccagcgaagcagata
ttaaaagtaaaagtatataaaggagttggttggagttcagattttagtccaacgcacttc
gatcgattctctccaccagacttttacacaaaggtttctattgctggagtgagagctgat
tgtgccaagaagaaaacaagtgtaaagatggacaattggaatcccatttgggacgaagag
tttgagttccgtttgacagttccggagctcgcgttgctccggatcgaagtaaaggataaa
gatcagacaaaagatgattttgctggacagacttgtttgccagtatcagagctaagacat
ggatttcggtctgttgctttgtgtgacagaaagggaaagaaatataactctgtcaagctt
ttacttggattccaactagaaactttgaaaatgttgtaa

DBGET integrated database retrieval system