KEGG   Medicago truncatula (barrel medic): MTR_3g072660Help
Entry
MTR_3g072660      CDS       T01716                                 

Definition
General transcription factor IIH subunit
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MTR_3g072660
  Replication and repair
   03420 Nucleotide excision repair
    MTR_3g072660
Transcription machinery [BR:mtr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MTR_3g072660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 452 aa AA seqDB search
MPEVRIIAKNFMDMVASMPAIKLDKLYQNGFICEAILRSLPPLAKKYVLQLLHIDGPVPA
KLLAEWVLPDGLSKHKVAIDRLVQLRVFVEAFDNRKNEKTYQVNSTYQKSLQNLLVHGGT
LPRESMPSNITVRLPTLEDLETYALEQWECFLLQLISPSHVDKTLNISSSLMKVFQRRLL
SQRDREAPKLTESGFQFLLMDTNAQLWYIIREYITNSEERGVDAGDLISFMLELSFHVIG
EAYNINTLTEFQRNIIKDLADLGLVKLQQGRKESWFIPTKLATNLSVSMTESSSRKEGFV
VVETNFRVYAYSTSKLHCEILRLFSRVEYQLPNLIVGAITKESLYNAFDNGITADQIVSF
LRQNAHPRVAQRVPAVPENVTDQIRLWESDLNRVEMTEAYYYDEFPSRDVFEGACDCARE
WSGLLWEDSKKMHLVVKSEVHTYVRDFLRRQK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggttaggatcattgccaagaatttcatggacatggtggcttcaatgcctgcc
atcaaacttgataaactctaccagaatggattcatctgcgaagctattctcaggtctctt
ccacctcttgcaaagaaatatgtgttacagttattgcatattgatggacccgtgccggct
aaattattggcggaatgggtgcttccagatggtctatcaaagcacaaagttgccattgat
agattggttcaattgagagtttttgttgaagcttttgacaacaggaagaacgaaaaaact
taccaagttaattcaacatatcagaaaagtctccagaatcttttagtacatggtggaact
ttgccgagggaatcaatgccttctaatattactgtgaggctcccaaccttggaggatctt
gagacttatgctctggaacaatgggagtgtttcttgttgcaacttataagcccaagtcat
gttgacaagaccttaaacataagctcttctttgatgaaagttttccagcggcgtctcctg
agtcagagagacagagaggctccaaaattaactgagagtggcttccaatttttgctgatg
gatacaaatgcacagctttggtacatcatcagggaatatatcactaattctgaggagaga
ggtgttgatgcaggtgacttgatatcattcatgctggagcttagttttcatgtcattggg
gaggcatataatataaacacattgaccgaatttcagaggaacataattaaggaccttgca
gaccttgggctggtcaaacttcaacagggcaggaaagaaagttggtttataccaacaaaa
ttagcaacaaacctttcagtgagcatgaccgaatcatcatcaagaaaagagggatttgtt
gttgtggaaacaaattttagagtttatgcttactcgacttcaaaattacactgtgagata
ttgcggttattttcaagggtagagtatcaacttccaaatcttattgttggagctattaca
aaagaaagcttgtataatgcttttgacaatggcattacagcagaccagatagtcagtttc
cttcggcagaatgctcatcctcgtgttgcacagagggtaccagcagtgcctgaaaatgtc
acagatcagattaggttgtgggaatcagatctaaatagagttgagatgacagaagcatat
tattatgacgagttcccatccagggatgtatttgaaggtgcgtgtgactgtgccagagaa
tggagtggtttattatgggaagattcaaagaagatgcatttggtggtcaagtctgaggtt
catacttacgtacgagattttttacgccgccaaaagtag

DBGET integrated database retrieval system