KEGG   Medicago truncatula (barrel medic): MTR_3g072990Help
Entry
MTR_3g072990      CDS       T01716                                 

Definition
Serine/threonine protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 742 aa AA seqDB search
MDGKSNLPIKSDSSSPPDFLRHVQAALKRHRPLGTGQSNIIRPRRTILRQPTHDLISNTN
IDSPETSTVIAPSQYANVPNKVPQGASDEKAIELENLSSYMSSLGFTEMEYIEGNRAEAS
IGLQDDLKQPKIQQVEPDFSLRSDGGMSCSMLPRRATVTRDDLQQFRNFLSQPATQSSVV
GPSCATTTSVHSTSAPMMNSTTRLHLDSGSRVGAEPLGEIGVYPIAERVMESENTEASGE
KDNKMSVDKAATAVQASDSCVGAELASKESDQSKKHQECMLKETGNLKYASSDVDKLTDG
KEPVDVAHVRCQAPVPKTSFLDVKSEYSKLEKPEKAASSKGSSVSKKRSYDPDLFFKVNG
KLYQRLGKIGSGGSSEVHKVISSDCRIYALKKIKLRGRDYATAFGFCQEIEYLNRLRGKD
NIIQLIDYEVTDKALLEQVMKGSLSNKDGRVKDDGYIYMVLEYGEIDLAHMLSQKWKELD
GSNETINENWLRFYWQQILQAVNTIHEERIVHSDLKPANFLLVKGSLKLIDFGIAKAIMS
DTTNIQRESQVGTLSYMSPEAFMCNETDANGNIIKCGRPSDIWSLGCILYQMVYGRTPFS
EYKTFWAKFKVITDPNHEIKYEPLSNPWLVDLMKRCLAWDRNQRWRIPQLLQHPFLAPHV
LPHPTLSQDSSSCKFVQLIAETCTYDPEASKLCQQLQRLLVDPIELTTHSLNSRDQQRTL
LSQMSDLCIQLRERLIDTDVKY
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaagtctaaccttccgatcaagtctgattcttcttccccaccggacttcctc
cgccacgttcaagccgccttgaagcgtcaccgtcctctcggtacagggcaatccaatatc
attaggccaagacgcacgattcttcgtcaaccaacacatgatttgatctcaaacacaaac
attgattcacctgaaactagcactgttattgctccttctcaatatgcaaatgttcccaat
aaagttccacagggggccagtgatgaaaaggccattgagttggagaatttatcttcttat
atgagttcacttggattcacagaaatggagtatatagaaggaaaccgagcggaagcttcg
attggattacaggatgatttaaagcaacccaaaattcagcaggttgagcctgatttcagt
ttgagatccgatgggggaatgagttgctctatgttgccgaggagagctacggttacacgg
gatgatttacagcagtttaggaactttctaagtcagccagcgacacagtcttcggttgtg
ggaccttcatgtgcgacaactacctcggttcattcaacttcagctcccatgatgaattca
acaacccgtttgcatctagatagtggctcgcgcgtgggtgctgaacctttgggagagatt
ggtgtttatcctatagctgaaagagttatggaatcagaaaatacagaagcttctggtgaa
aaagacaataaaatgtcagttgataaggctgcaactgcggtgcaagcttctgattcttgt
gtcggtgccgagttggcatctaaagagagtgatcaatcaaagaagcaccaagaatgcatg
ttaaaagaaactggcaatttgaaatatgcttcttctgatgttgacaagttaaccgacggg
aaagagcctgtagatgttgcccacgtacggtgtcaggctccagtgcccaaaacatcattt
ttggatgtgaaatctgaatattctaagttagaaaaaccagagaaggctgcaagtagtaaa
ggttcatcggtctctaagaaaaggtcttatgatcctgatttatttttcaaggttaatgga
aagctttatcaacgtcttggcaagataggtagtggtggaagcagtgaggtgcacaaggtg
atttcatcagattgtaggatatatgcacttaagaagatcaaactcaggggtcgtgattat
gctactgcttttggattttgtcaagagatcgaatatctaaataggctgagaggaaaggat
aatatcatacagcttatagattatgaggttactgacaaggctttgcttgaacaagtcatg
aaaggctctcttagtaataaggatggccgagtcaaggatgatggatatatatacatggta
cttgaatatggcgaaattgatttagctcacatgttgtcccagaagtggaaggagttggat
ggatccaacgagaccataaatgagaactggcttcgattttactggcagcaaattcttcaa
gctgtcaatactattcacgaggaacgtattgtgcactctgacttgaagcctgctaacttc
ctcctcgtcaagggttccctaaaactgattgattttggtatagccaaagcaataatgagc
gatactactaatatccaacgagaatcacaggttggtactctgagttacatgtctccggaa
gcatttatgtgtaatgagactgatgcgaacggaaacatcatcaagtgtggtcggccgtca
gatatctggtctttgggatgcatcctttatcaaatggtatatgggagaacccccttttca
gaatacaagacattttgggccaaatttaaagttataacagatccaaatcatgaaattaag
tatgaaccactttcaaatccatggctagtagatcttatgaagaggtgtctagcatgggat
cgcaatcaaaggtggagaattcctcagttactccaacatccttttcttgcacctcatgta
ctgcctcatccaactttgtcccaagacagcagcagctgtaaatttgtacaacttattgct
gaaacttgtacatatgaccctgaagcatccaaactttgtcagcagctccaacgtcttctt
gttgacccaattgagttaacgactcactcactaaactcacgagatcaacaaagaacattg
ttgtcccaaatgtctgatctctgtattcagctgcgggaacgtttgatagatactgatgtc
aaatattag

DBGET integrated database retrieval system