KEGG   Medicago truncatula (barrel medic): MTR_3g077160Help
Entry
MTR_3g077160      CDS       T01716                                 

Definition
Histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 476 aa AA seqDB search
MGSGEMGVAESGGASLPSIGADAMKRRVTYFYEPSIGDYYYGQGHPMKPHRIRMAHNLII
HYSLHRRMQINRPFAAAPEDIRRFHSDDYVEFLSSVSPEIVSDNSHSHYRQLKRFNVGED
CPVFDGLFPFCQASAGGSIGAAVRLNRGDADIAINWAGGLHHAKKAEASGFCYVNDIVLG
ILELLKVHRRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIKDTGVGPG
KDYALNVPLNDGMDDENFRALFRPIMQKVMDVYQPDAVVLQCGADSLSGDRLGCFNLSVK
GHADCLRFLRSFNVPLMVLGGGGYTVRNVARCWCYETAVAVGVEPSNKLPYNEYYEYFGP
DYTLHVEPNNMENLNTPKDMEKIRNTLLEQIARLPHAPSAPFQTTPSTAEVPEVEEEDMD
IRPKRQLWSGEDYDSDPDEDEKANIRSSSLTSHMRRAADMMEEDKPEVKPGVHPPC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcggcgaaatgggtgtagctgagagcggtggcgcatcacttccttcaatcggc
gccgacgcaatgaagcgtcgcgtaacctacttctacgaaccaagcatcggtgattattac
tacggtcaaggtcacccaatgaaaccccatcgtatccgcatggcacacaatctcatcatc
cactactctctccaccgtcgtatgcaaattaaccgtcctttcgccgctgcgccggaagat
atccgccggtttcactctgatgattacgtcgagttcctctcttccgtttcgccggagatt
gtttcggataattcacactctcattatcggcagttgaagaggtttaacgtaggtgaggat
tgtcctgttttcgacgggctttttccgttctgccaggcttctgctggtggatctattggt
gctgctgttaggcttaatcgtggtgacgctgatattgctattaattgggctggtgggttg
catcatgctaagaaagctgaagcttctgggttttgttatgttaatgacattgttcttggg
attcttgagcttctcaaagttcataggcgtgttctgtatgttgatattgatgtccaccac
ggagatggcgttgaggaggcattttacactactgatcgagtgatgactgtgtcttttcat
aagtttggtgatttcttccctggaactgggcatattaaagacactggtgtgggccctggg
aaggactatgctctaaatgttccattgaatgatggaatggatgatgagaatttccgtgct
ctgtttcgtcccattatgcaaaaagtcatggatgtttatcaacctgatgcagttgttctt
caatgtggagctgattctttgtccggtgacaggttgggttgcttcaacttatctgtgaag
ggtcatgcagactgccttcgtttccttaggtcttttaatgttcctctaatggtcttgggt
gggggaggatacactgtacggaatgttgctcgctgttggtgttatgagacagccgtagca
gtaggagtggagcctagtaacaagttgccatataatgagtattatgaatattttggccca
gactatacacttcatgtcgaaccaaacaacatggagaacctaaacacacccaaggatatg
gaaaaaatcaggaacactttgcttgaacaaattgccagacttcctcatgctcccagtgct
ccttttcagacaacaccatcaaccgcagaagttcctgaagtggaagaagaggacatggat
ataagaccaaaacgtcagttgtggagtggtgaagattatgattctgatcccgatgaagat
gagaaggccaatataaggagctcaagtttaacttctcatatgaggcgcgcagcagatatg
atggaagaagataagccagaagttaagcctggtgtgcatccgccatgctaa

DBGET integrated database retrieval system