KEGG   Medicago truncatula (barrel medic): MTR_3g079840Help
Entry
MTR_3g079840      CDS       T01716                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase-like protein
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_3g079840
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MTR_3g079840
Ubiquitin system [BR:mtr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    MTR_3g079840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1119 aa AA seqDB search
MTVMMSAPIDQQEDEEVLVPHADLPENNNHQPMEVVAQPETANTVESQPVPDPPQTRFTW
RIDNFTRLNTKKLYSEVFVVGAYKWRVLIFPKGNNVDYLSMYLDVADSTSLPYGWSRYAQ
FSLAIVNQIHNKFTVRKDTQHQFNARESDWGFTSFMPLGELYDPSRGYLVNDTLIIEAEV
LVRKIVDYWNYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPS
GSIPLALQSLFYKLQYSDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKG
TVVEGTIQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCRDVYASFDKYVEVERL
EGDNKYHAEQYGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPSQLDL
DRENGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSEQWYKFDDERVTKE
DNKRALEEQYGGEEELPQTNPGFNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIA
EHLRERLKKEQEEKEHKKKEKAEAHLYTIIKVARDEDIEGQMGKDIYFDLVDHDKVRSFR
VQKQTPFNVFKEEVAKEFGIPVQFQRFWLWAKRQNHTYRPNRPLTQIEETQTVGQLREVS
NKVHNAELKLFLEVEKGMDLCPIAPPDKTKDDILLFFKLYDPEKEELRYVGRLFVKCTGK
PSEILTRLNEMAGYVPEEDIVLYEEIKFEPNVMCEPIDKKVTFRASQLEDGDIVCFQKAP
LVDNEEQVRYPDVPSYLEYVHNRQVVHFRSLDRPKEDDFSLEMSRLYTYDDVVERVAQQL
GLDDPSKIRLTPHNCYSQQPKPQPIKHRGVDHLSDMLVHYNQTSDILYYEVLDIPLPELQ
GLKTLKVAFHHAIKDEVVSHTIRLPKQSTVGDVLDDLKTKVELSHPDAELRLLEVFYHKI
YKVFPSNEKIENINDQYWTLRAEEIPEEEKNIGPQDRLIHVYHFTKDTAQNQMQIQNFGD
PFFLVIHEGEALSEIKVRIQKKLQVPDEEFSKWKFAFLSLGRPEYLQDSDIVSSRFQRRD
VYGAWEQYLGLEHTDNAPKRSYAVNQNRHTFEKPVKIYN
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatgatgtccgctcccattgaccagcaagaggatgaagaagtgctcgtgcca
cacgctgatttgcccgagaacaacaatcatcagcctatggaagttgtagctcaacctgaa
actgccaataccgtggagagccagcctgtcccggatcctccacaaaccagattcacatgg
agaattgacaattttactaggctgaatacaaaaaagctctattcagaagtattcgttgtt
ggtgcttataaatggcgtgtgcttattttcccaaaaggaaacaatgtggactatttgtcc
atgtatttggatgtcgcggattcaactagtttgccctatggttggagtagatatgcacag
tttagtttggcaattgttaatcaaatccataataagttcaccgtgagaaaagacacacaa
catcaatttaatgcgcgagaaagtgattggggtttcacatctttcatgcctcttggtgaa
ttgtatgatcctagtagagggtatctcgtgaatgatactcttataatcgaagcagaggtt
cttgttcgtaagattgttgattactggaattatgactcaaagaaggagaccggctatgtt
gggctcaagaatcaaggagctacctgttatatgaattctctacttcaaacattgtaccat
attccttattttaggaaggctgtgtaccatatgccaacaactgaaaatgatatgccctcg
ggaagcatccctttggctctgcaaagtttattctacaagctccaatatagtgacaccagc
gttgcaacaaaggagctgacaaaatcttttggatgggatacatatgattctttcatgcag
catgatgttcaagaactaaatcgggtcctctgtgaaaaacttgaagacaaaatgaaggga
accgttgttgagggaactatacaaaagctatttgaaggacaccatatgaactacatagag
tgcatcaatgtggactacaaatcaactagaaaggagtcattttatgaccttcagcttgat
gtcaaaggctgtcgcgatgtttatgcttcctttgataagtatgttgaagttgaacgtctt
gagggggataacaaatatcacgctgaacaatatggtttgcaggatgctaagaagggtgtc
ctatttattgattttcctcctgttcttcagcttcagctcaaaagatttgaatatgacttt
atgcgggatactatggttaagattaatgaccgttatgagtttccctcacaacttgatctt
gatcgtgagaatggaaaatatctatcacctgatgctgacaggagtgtccgcaatctttac
acacttcacagtgttttggttcacagtgggggcgtgcatggtgggcattattatgctttt
atcaggccaactctctctgaacagtggtacaaattcgatgatgagagggtgacgaaagaa
gacaataagcgggcactagaggagcaatatggtggtgaggaagagttaccgcaaacaaat
cctgggttcaataacccaccatttaaattcaccaaatattcaaatgcttatatgctggtg
tatatacgtgaaagtgacaaggacaaaatcatatgcaacgtggatgagaaagacattgct
gaacatttaagggagaggttgaagaaagaacaagaagaaaaagagcacaaaaagaaagaa
aaggctgaggcgcatctttatacaattatcaaggtggcacgggatgaagacattgaaggg
cagatgggaaaggatatctactttgatcttgtagaccacgacaaagtgagaagtttccgt
gtacaaaagcagacaccttttaatgttttcaaggaagaggttgcaaaagagtttggtata
ccagttcaatttcagcgcttttggctgtgggctaagcgtcaaaaccatacttatcggcct
aatagaccgctgacacaaattgaggaaacacaaactgtcggacaattgagagaagtgtca
aacaaggttcataatgcagaactgaagttgtttttggaagtggagaaggggatggattta
tgtcccattgcaccacctgacaagacaaaggacgatatattacttttctttaagctatat
gatcctgaaaaagaggagcttcgctatgttggaaggctctttgtgaagtgtactggcaag
ccatcagaaatcttaacaaggctaaatgaaatggctggttatgttcctgaagaagatatt
gtactttatgaggagattaagtttgagccaaatgtcatgtgcgaacctattgataagaaa
gtaacatttcgagcaagccagctggaggatggagatattgtatgctttcagaaagctccc
ttagtagataatgaggaacaagttcgctatccagatgtgccctcatatttagaatatgtt
cataaccgccaggtggttcattttcgatcattggacagacccaaggaagatgacttctct
ttggagatgtcaagactttatacatatgatgatgtggtggagagagtagctcaacaactt
ggcttggatgatccatccaaaatacgtcttacccctcacaactgctactctcaacaaccg
aaaccccagcctattaagcaccgaggggtggatcatttgtctgatatgctagttcattac
aatcagacatcagatatattatactatgaagtgctcgacatccctctacccgaattacaa
ggcttgaaaactctgaaagttgcatttcatcatgccatcaaggacgaggtggttagtcac
actatcagactcccaaagcagagcactgttggagatgtccttgatgatcttaaaaccaag
gtggagttatctcatcctgatgctgagctaaggttgcttgaagtcttctatcacaagata
tacaaggtgtttccatccaatgaaaagattgaaaatattaatgatcaatactggacattg
cgagcagaggagattccagaagaagagaaaaacattggtccacaggatcgtctaattcat
gtgtaccattttactaaagacactgctcaaaatcaaatgcaaattcaaaacttcggggat
ccctttttcttggttatacacgaaggtgaagctctatctgaaattaaagtgcgaatacag
aagaaacttcaagttcctgacgaagagtttagcaagtggaagtttgcttttctatcactt
gggcgtccagagtaccttcaggattcagacattgtatccagtcgttttcagaggcgagat
gtttatggtgcttgggagcaatatcttggcttggagcatactgacaatgctcctaaaaga
tcatatgctgtcaaccagaatcgtcacacgtttgagaagccagtaaagatttataattag

DBGET integrated database retrieval system