KEGG   Medicago truncatula (barrel medic): MTR_3g083910Help
Entry
MTR_3g083910      CDS       T01716                                 

Definition
(RefSeq) chalcone and stilbene synthase family protein
  KO
K00660  chalcone synthase [EC:2.3.1.74]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00941  Flavonoid biosynthesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr04712  Circadian rhythm - plant
Module
mtr_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    MTR_3g083910
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    MTR_3g083910
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     MTR_3g083910
Polyketide biosynthesis proteins [BR:mtr01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    MTR_3g083910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III_C ACP_syn_III FAE1_CUT1_RppA CinA
Motif
Other DBs
NCBI-GeneID: 11439469
NCBI-ProteinID: XP_003601647
UniProt: G7JA70
Position
3
AA seq 389 aa AA seqDB search
MVTFDEIRQAQRADGPATVLAIGTATPQNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC
DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP
KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAEN
NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPQVEKPLFELV
WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALAEAFQPLGISDYNSIFW
IAHPGGPAILDQVEAKLSLKPEKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLAT
TGEGLEWGVLFGFGPGLTVETVVLHSVAT
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtgacatttgatgagatccgccaggcacagagggctgatggccctgccaccgtgttg
gcaatcggcactgcaactcctcaaaactgcgtggaccagagcacataccctgactactat
ttccgcatcacaaacagtgaacataagactgagctcaaagaaaaatttcagcgcatgtgt
gataagtcaatgatcaagaagagatacatgtacttgacagaagagatcctgaaagagaat
ccaagtgtatgcgagtacatggcaccttcattggatgcaagacaagacatggtggttgtg
gaggtaccaagactaggaaaagaggcagcaacaaaggccatcaaggaatggggtcaacct
aagtccaagattacccacctcatcttttgcaccaccagtggcgtggacatgcccggtgcc
gactatcagctgacaaagctcttgggccttcgtccatatgtgaagcgttacatgatgtac
caacaaggttgttttgctggtggcacggtgcttcgtttggctaaagacttggctgaaaac
aacaaaggtgctcgtgtgttggtagtttgttcagagataactgcagttactttccgtgga
cccagtgacactcatcttgatagccttgtggggcaagcattgtttggagatggtgcagca
gctgtgatcgtaggttcagacccattaccacaagttgagaaacccttgtttgaattggta
tggactgcacaaacgatccttccagatagtgaaggagcaattgacggtcaccttcgtgaa
gtcgggcttacattccatctcctcaaggatgttcctggtcttatctcaaagaacattgag
aaagctcttgctgaggcctttcaacctttaggtatctctgattacaattccatcttttgg
atcgcacaccctggtggaccagcaattctggaccaagtggaagccaaattaagcttaaag
ccagagaaaatgcaagccactcgacatgtgcttagcgagtatggtaacatgtcaagtgca
tgtgtgttattcatcttggatgagatgaggaggaagtcaaaagaagacggacttgccaca
acaggcgaggggctggaatggggtgtcctatttggtttcgggcccggactcactgttgag
actgtagtgctccacagtgttgccacttaa

DBGET integrated database retrieval system