KEGG   Medicago truncatula (barrel medic): MTR_3g083910Help
Entry
MTR_3g083910      CDS       T01716                                 

Definition
Chalcone synthase
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    MTR_3g083910
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    MTR_3g083910
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     MTR_3g083910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 389 aa AA seqDB search
MVTFDEIRQAQRADGPATVLAIGTATPQNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC
DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP
KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAEN
NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPQVEKPLFELV
WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALAEAFQPLGISDYNSIFW
IAHPGGPAILDQVEAKLSLKPEKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLAT
TGEGLEWGVLFGFGPGLTVETVVLHSVAT
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtgacatttgatgagatccgccaggcacagagggctgatggccctgccaccgtgttg
gcaatcggcactgcaactcctcaaaactgcgtggaccagagcacataccctgactactat
ttccgcatcacaaacagtgaacataagactgagctcaaagaaaaatttcagcgcatgtgt
gataagtcaatgatcaagaagagatacatgtacttgacagaagagatcctgaaagagaat
ccaagtgtatgcgagtacatggcaccttcattggatgcaagacaagacatggtggttgtg
gaggtaccaagactaggaaaagaggcagcaacaaaggccatcaaggaatggggtcaacct
aagtccaagattacccacctcatcttttgcaccaccagtggcgtggacatgcccggtgcc
gactatcagctgacaaagctcttgggccttcgtccatatgtgaagcgttacatgatgtac
caacaaggttgttttgctggtggcacggtgcttcgtttggctaaagacttggctgaaaac
aacaaaggtgctcgtgtgttggtagtttgttcagagataactgcagttactttccgtgga
cccagtgacactcatcttgatagccttgtggggcaagcattgtttggagatggtgcagca
gctgtgatcgtaggttcagacccattaccacaagttgagaaacccttgtttgaattggta
tggactgcacaaacgatccttccagatagtgaaggagcaattgacggtcaccttcgtgaa
gtcgggcttacattccatctcctcaaggatgttcctggtcttatctcaaagaacattgag
aaagctcttgctgaggcctttcaacctttaggtatctctgattacaattccatcttttgg
atcgcacaccctggtggaccagcaattctggaccaagtggaagccaaattaagcttaaag
ccagagaaaatgcaagccactcgacatgtgcttagcgagtatggtaacatgtcaagtgca
tgtgtgttattcatcttggatgagatgaggaggaagtcaaaagaagacggacttgccaca
acaggcgaggggctggaatggggtgtcctatttggtttcgggcccggactcactgttgag
actgtagtgctccacagtgttgccacttaa

DBGET integrated database retrieval system