KEGG   Medicago truncatula (barrel medic): MTR_3g088610Help
Entry
MTR_3g088610      CDS       T01716                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTR_3g088610
Enzymes [BR:mtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MTR_3g088610
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTR_3g088610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 413 aa AA seqDB search
MASSSTIPNTPLTLNSHTYVDLKPALPLKNYLSFSSSKRRPPCLFTVRASDADFEAAVVA
GNVPDAPPVPPTPAAPAGTPVVTSLPIQRRPRRNRRSATHRSAFQETTLSPANFVYPLFI
HEGEEDTPIGAMPGCYRLGWRHGLIEEVAKARDVGVNSVVLFPKIPDALKTPTGDEAYNE
NGLVPRTIRLLKDKYPDLVIYTDVALDPYSSDGHDGIVREDGVIMNDETVHQLCKQAVAQ
ARAGADVVSPSDMMDGRVGAMRAALDAEGFQHVSIMSYTAKYASSFYGPFREALDSNPRF
GDKKTYQMNPANYREALTEMREDETEGADILLVKPGLPYLDIIRLLRDNSPLPIAAYQVS
GEYSMIKAGGALKMIDEEKVMMESLLCLRRAGADIILTYFALQAARCLCGEKR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcttcaacaatcccaaacacacccttaaccttaaattctcatacctacgtt
gatcttaaaccagcactaccattgaagaactatttgagcttctcttcatcaaagcgtcga
cctccatgtctttttactgtcagagctagtgacgcagattttgaagccgctgttgtcgct
ggtaatgtgccggatgcgcctcctgtaccgcctacaccggctgcacctgctggaacgcca
gtggtcacttcacttccaattcagaggcgtcctcgtcgtaatagaagatcagctacacat
cgatcggcgtttcaggaaacaactttatcacctgctaattttgtttatccactttttata
cacgagggtgaggaggacacccctattggtgctatgcccggatgctacaggcttggttgg
agacatggacttattgaagaggttgcaaaagcacgggatgttggtgttaacagtgttgtg
ctcttccccaaaattccagatgctttgaagacccccacaggagatgaagcatacaatgag
aatggcttagtgcctcgaactatacgactacttaaggataaataccctgatcttgttatt
tatacagatgttgcattagacccatattcttcagatgggcatgacggcattgttagagaa
gatggagttatcatgaatgatgagactgttcatcagctttgtaaacaagctgtagcccag
gctcgtgctggagcagatgtggtcagccccagcgatatgatggatggtcgtgttggagcg
atgcgagcagctctcgatgctgaaggctttcagcatgtttctataatgtcatatacagca
aagtacgcgagttcattttatggcccatttagggaagcattggactcaaacccccgtttt
ggagataaaaagacctatcagatgaacccggcaaattatagagaggctttgactgagatg
agggaagatgaaactgaaggagccgacatcctcttggtgaagcctggtcttccctatttg
gatatcatcaggctactcagggataattctccacttccaattgcagcataccaggtttct
ggtgagtactctatgattaaagctggtggtgcgctgaaaatgattgacgaagaaaaggtc
atgatggagtcattattgtgcctccgacgggccggtgctgacatcatcctaacatatttt
gctctacaagctgccagatgtttgtgtggagagaagaggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system