KEGG   Medicago truncatula (barrel medic): MTR_3g089940Help
Entry
MTR_3g089940      CDS       T01716                                 

Definition
Alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MTR_3g089940
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_3g089940
  Lipid metabolism
   00071 Fatty acid degradation
    MTR_3g089940
  Amino acid metabolism
   00350 Tyrosine metabolism
    MTR_3g089940
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MTR_3g089940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 380 aa AA seqDB search
MSSTAGQVIKCKAAVAWEAGKPLVMEEVEVAPPQAGEVRLKILFTSLCHTDVYFWEAKGQ
TPLFPRIFGHEAGGIVESVGEGVTHLKPGDHALPVFTGECGDCPHCKSEESNMCDLLRIN
TDRGVMINDNQSRFSIKGQPIHHFVGTSTFSEYTVVHAGCVAKINPDAPLDKVCILSCGI
CTGLGATINVAKPKPGSSVAIFGLGAVGLAAAEGARISGASRIIGVDLVSSRFELAKKFG
VNEFVNPKDHDKPVQQVIAEMTNGGVDRAVECTGSIQAMISAFECVHDGWGVAVLVGVPN
KDDAFKTHPMNLLNERTLKGTFYGNYKPRTDLPNVVEKYMKGELELEKFITHTIPFSEIN
KAFDYMLKGESIRCIIRMEE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtacagctggtcaagtcatcaaatgcaaagctgcggttgcatgggaggcaggg
aagccactggtgatggaggaagtggaggtggcgccaccgcaggccggtgaagtccgtctc
aagatactcttcacctctctttgtcacactgatgtttacttctgggaagctaagggtcaa
actccattgtttcctcgtatctttggtcatgaagctggagggattgtggagagtgtaggt
gagggtgtgactcatctgaaaccaggggatcatgccctgcctgtattcacaggggagtgt
ggggactgtccacattgtaagtcagaggaaagcaacatgtgtgatcttcttaggatcaac
actgacaggggtgttatgatcaatgacaatcagtcaagattctctattaagggacagccc
attcaccattttgtcggtacatcgacattcagtgaatacactgtggttcatgctggatgt
gttgcaaagatcaaccctgatgcacctcttgataaagtttgtattctcagctgtggaata
tgcacaggtcttggtgctaccatcaatgttgctaaaccgaaacccggttcttctgttgct
atctttggacttggagctgttggccttgctgctgctgaaggagcaaggatatctggtgca
tcaagaatcattggagtcgatttagtttccagccgtttcgaattagctaagaagtttggg
gtaaatgagtttgtgaacccaaaagatcatgacaaacctgtacaacaggtaattgctgaa
atgacaaatggaggtgtagatcgtgctgttgaatgtaccggtagcatacaagctatgata
tcggcatttgaatgtgtccatgatggttggggtgttgctgtacttgttggagtgccaaac
aaagatgatgcattcaaaactcatcctatgaatttgttgaatgaaaggactcttaagggt
accttttatggaaactacaaaccccgcaccgatcttcctaatgttgtagaaaagtacatg
aaaggggagctggaacttgagaaattcatcactcacacaattccattttcagagattaac
aaagcttttgattacatgttgaaaggagagtccatcagatgtatcatccgaatggaggag
taa

DBGET integrated database retrieval system