KEGG   Medicago truncatula (barrel medic): MTR_3g100160Help
Entry
MTR_3g100160      CDS       T01716                                 

Definition
NADPH cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 692 aa AA seqDB search
MTSSNSDLVRTIESVLGVSLGDSVSDSVVLIVTTSAAVIIGLLVFLWKKSSDRSKELKPV
IVPKSLVKEEDDDADIADGKTKVTVFFGTQTGTAEGFAKALAEEIKARYEKAFVKVVDMD
DYAADDDQYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDERGTWLQQLTYGV
FGLGNRQYEHFNKIGKVVDDDLSEQGAKRLVPLGMGDDDQSIEDDFNAWKESLWPELDQL
LRDEDDVNTVSTPYTAAISEYRVVFHDPTVTPSYENHFNAANGGAVFDIHHPCRANVAVR
RELHKPQSDRSCIHLEFDVSGTGVTYETGDHVGVYADNCDETVKEAGKLLGQDLDLLFSL
HTDNEDGTSLGGSLLPPFPGPCTVRTALARYADLLNPPRKAALIALAAHASEPSEAERLK
FLSSPQGKDEYSKWVVGSHRTLLEVMADFPSAKPPLGVFFAAIAPRLQPRYYSISSSPRF
APQRVHVTCALVEGPTPTGRIHKGVCSTWMKNAIPSEESRDCSWAPIFIRPSNFKLPADP
SIPIIMVGPGTGLAPFRGFLQERFALKEDGVQLGPALLFFGCRNRQMDFIYEEELNNFVE
QGSLSELIVAFSREGPEKEYVQHKMMDKASYFWSLISQGGYLYVCGDAKGMARDVHRTLH
TIVQQQENADSSKAEATVKKLQMDGRYLRDVW
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttccaattccgatttagtccgtacaatcgaatccgtactcggagtttccctc
ggcgactccgtttcagattcggttgttctcatcgttaccacctccgccgccgtcataatt
ggacttctcgtttttctatggaagaaatcttcggatcggagcaaagagttgaaaccggtt
atagttcctaagtccttggtgaaagaagaagatgatgatgctgatattgctgatggaaaa
accaaagttaccgttttctttggtactcaaactggtactgctgaaggattcgctaaggca
ttggcagaggagatcaaggcaagatatgaaaaagcatttgtcaaagttgttgatatggat
gactatgcagcggatgatgatcaatatgaagagaagctgaagaaagaaactcttgcattt
ttcatgctggcgacttatggagatggagagccaactgacaatgccgcaagattctataaa
tggtttactgagggtaaagacgagaggggaacctggcttcaacagctcacatatggtgtt
tttggcctaggtaacaggcaatatgaacattttaacaagataggtaaagttgttgacgac
gatctcagtgaacaaggggcaaagcgtcttgttccacttggaatgggtgatgatgatcaa
tccattgaggatgattttaatgcctggaaagaatctctgtggcctgagttggatcagttg
ctccgagatgaggatgatgtaaatactgtgtctactccttatacagctgctatttctgaa
tatcgagtagtgtttcacgaccccactgtcacgccgtcctacgagaatcactttaacgcg
gcaaatgggggtgctgtatttgatattcatcatccttgtagggcgaatgtcgctgttcga
agggagcttcataaacctcagtctgaccgttcttgtatacatttggagtttgatgtatca
gggaccggcgtaacatacgaaactggagaccatgtgggtgtttatgctgataactgtgat
gaaactgttaaagaagctgggaagttgttgggtcaggatttagatttgctgttttctctt
cacactgataatgaggatggcacttccctaggtggttctcttctacctcctttccctggt
ccttgcacagttcgcactgcattagcacgttatgcagatctcttgaaccccccacgaaag
gctgctttaattgcattagctgctcatgcttccgagcctagtgaagcagaaagattgaag
tttctctcatctcctcagggaaaggatgaatactccaaatgggttgttggaagccataga
actcttcttgaggtgatggctgattttccatcagcaaaaccaccccttggtgtgtttttt
gctgccatagcccctcgtttacaacctcgttattattctatttcatcatctcctaggttt
gccccacaaagggtacacgtaacttgtgccctggtagaaggtccaactccaactggcaga
attcacaaaggagtatgttcaacctggatgaagaatgctattccctcagaggaaagccgt
gactgtagctgggctcccatttttatcaggccatcgaatttcaagctacctgctgatcct
tcaattcctattattatggttggacctggtactggtttagcaccttttaggggattttta
caggagagatttgctctcaaagaggacggtgttcaacttggtcctgcattactattcttc
gggtgcaggaaccgtcaaatggattttatatatgaggaagagctgaataattttgtggaa
caaggttctctgtcagagttgatagttgcattctctagagaggggcctgaaaaggagtat
gttcaacacaaaatgatggataaagcatcatacttctggagtctcatttctcagggaggt
tatctttatgtatgtggtgatgccaagggcatggccagagatgttcatcgaactcttcac
accattgtccagcagcaggaaaatgcagactcttcaaaggcggaggctacggtgaaaaaa
ctccagatggatggacgctaccttagggatgtctggtga

DBGET integrated database retrieval system