KEGG   Medicago truncatula (barrel medic): MTR_3g101350Help
Entry
MTR_3g101350      CDS       T01716                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mtr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 308 aa AA seqDB search
MAQFCVSPFCSSPSPPCLQLHRQHQFFFISQPKIAPPPPSASATDSTFTIASTSSNLTPK
VVVTRERGKNSKLITALAKHEINCLELPLIEHLRGPDFDKLPTLLTDYAFDWVIITSPEA
GSVFLEAWRAAGMPRVRIGVVGSGTASIFKDALLSSNQSLDVAFSPSKATGKVLATELPR
IGNKTTILYPASAKASNEIEEGLSSRGFEVTRMNTYTTVPVQHVDQMILKQALAAPVVTV
ASPSAIRAWKNLLSDSDWSNSVACIGETTAAMAGRLGFKNVYHPTQPGLEGWVESILEAL
GSYDDLSR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattttgtgtctcccctttctgttcttcaccttctcctccttgtcttcaactt
caccggcagcatcaattcttcttcatttctcaaccaaaaattgctcctcctcctccttct
gcttccgccaccgattctactttcactatcgcttccacttcttctaatttaacgccaaaa
gtcgtcgtcaccagagaacgtggcaagaattccaagctcatcactgctttggccaaacat
gaaatcaattgtttggagcttccactcattgagcacctacgaggacctgatttcgacaag
cttcctactttattaactgattatgcatttgattgggttatcatcacttctcctgaggct
ggttcagtctttctagaggcatggagagctgctgggatgcctcgcgttagaataggcgtt
gttggatcaggtactgcaagcattttcaaggatgctttgctgtcatcaaaccaatcactt
gatgttgccttttcaccttcaaaagcaacaggaaaagttttggctacagagcttcccaga
attggaaataaaactaccattctatatcctgcttctgcaaaggctagcaatgagattgag
gaagggctttcaagtcgtggatttgaagttacaaggatgaacacatatacaacggtacca
gttcaacatgttgatcagatgattctaaagcaagcacttgctgcccccgttgttacagta
gcttcaccatctgcaattcgagcctggaagaatctcctttcggattccgactggagcaat
tcagttgcatgcattggggagacaactgctgccatggcaggaagattaggcttcaaaaat
gtgtaccacccaacacaaccaggccttgaaggctgggttgaaagcatccttgaagcatta
ggatcctatgatgatttatcgaggtag

DBGET integrated database retrieval system