KEGG   Medicago truncatula (barrel medic): MTR_3g101350Help
Entry
MTR_3g101350      CDS       T01716                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTR_3g101350
Enzymes [BR:mtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MTR_3g101350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 308 aa AA seqDB search
MAQFCVSPFCSSPSPPCLQLHRQHQFFFISQPKIAPPPPSASATDSTFTIASTSSNLTPK
VVVTRERGKNSKLITALAKHEINCLELPLIEHLRGPDFDKLPTLLTDYAFDWVIITSPEA
GSVFLEAWRAAGMPRVRIGVVGSGTASIFKDALLSSNQSLDVAFSPSKATGKVLATELPR
IGNKTTILYPASAKASNEIEEGLSSRGFEVTRMNTYTTVPVQHVDQMILKQALAAPVVTV
ASPSAIRAWKNLLSDSDWSNSVACIGETTAAMAGRLGFKNVYHPTQPGLEGWVESILEAL
GSYDDLSR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattttgtgtctcccctttctgttcttcaccttctcctccttgtcttcaactt
caccggcagcatcaattcttcttcatttctcaaccaaaaattgctcctcctcctccttct
gcttccgccaccgattctactttcactatcgcttccacttcttctaatttaacgccaaaa
gtcgtcgtcaccagagaacgtggcaagaattccaagctcatcactgctttggccaaacat
gaaatcaattgtttggagcttccactcattgagcacctacgaggacctgatttcgacaag
cttcctactttattaactgattatgcatttgattgggttatcatcacttctcctgaggct
ggttcagtctttctagaggcatggagagctgctgggatgcctcgcgttagaataggcgtt
gttggatcaggtactgcaagcattttcaaggatgctttgctgtcatcaaaccaatcactt
gatgttgccttttcaccttcaaaagcaacaggaaaagttttggctacagagcttcccaga
attggaaataaaactaccattctatatcctgcttctgcaaaggctagcaatgagattgag
gaagggctttcaagtcgtggatttgaagttacaaggatgaacacatatacaacggtacca
gttcaacatgttgatcagatgattctaaagcaagcacttgctgcccccgttgttacagta
gcttcaccatctgcaattcgagcctggaagaatctcctttcggattccgactggagcaat
tcagttgcatgcattggggagacaactgctgccatggcaggaagattaggcttcaaaaat
gtgtaccacccaacacaaccaggccttgaaggctgggttgaaagcatccttgaagcatta
ggatcctatgatgatttatcgaggtag

DBGET integrated database retrieval system