KEGG   Medicago truncatula (barrel medic): MTR_3g105430Help
Entry
MTR_3g105430      CDS       T01716                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit B
  KO
K03253  
translation initiation factor 3 subunit B
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_3g105430
Messenger RNA biogenesis [BR:mtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     MTR_3g105430
Translation factors [BR:mtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MTR_3g105430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 716 aa AA seqDB search
MADVMLMKEIEDKALLLGIDLSSIDLDSIHLPPGDNCGIPSDDDVDQEENLEFDSGFGNI
IVVDNLPVVPKEKFEKLVTVVRKIYSQIGAIKEDGLWMPVDPATEKSLGYCFIEYNTPQE
AELAKEKTQGYKLDRSHIFSVSMFDDFDRFMKVPDEWAPPPNKEYAPGENLQQWLTDAKA
RDQFVIRAGSDTEVLWNDAKLLKPDPVYKRAFWTESFVQWSPLGTYLATVHRQGAAVWGG
ATTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDF
KGSADDFAIGGTGGVTGVSWPVFKWSGGRDDKYFARMGKNVLSVYETETFSLVDKKSLKV
ENIMDFSWSPTDPIISLFVPETGGGNQPARVSLVQIPSKEELRQKLLFNVSDCKMYWQSN
GEYLAVNVDRYTKTKKSTFTGFELFRIKERDIPIEVLELENKNDKIIAFAWEPKGHRFAV
IHGDNPKPDISIYSMRTAQNTGRVSKLTTLKGKQANALFWSPAGRFIVLAGLKGFNGLLE
FYNVDELETMANTEHFYATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKD
HFFQFLWRPRPASFLTAEKEEEIAKNLKKYSKKYEAEDQDVSLLLSEQEREKRRVLKEDW
DKWANEWKLLHEEEKLERENLRDGEASDEEEEYEAKDIEVEEVVDVTKEILQVEEY
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgtaatgctaatgaaagaaattgaagacaaagcgttgcttcttggtatcgat
ctatcctctatcgatcttgattccattcacctccctccaggtgacaactgcggaatcccc
agcgacgatgatgttgatcaagaggagaatctggagtttgattctggatttggcaatatt
attgtagtggataatctacccgttgttcccaaggagaaattcgagaagcttgtaacagtt
gttaggaaaatttatagtcagattggtgctattaaagaggacggtctctggatgcctgtt
gatcccgctactgaaaagtccttaggttattgcttcatcgagtacaacactcctcaggaa
gctgagcttgctaaagagaagactcagggatacaaactggatcgttcccatatattttct
gttagtatgttcgatgattttgatcgattcatgaaagtgccagacgagtgggctcctcct
ccaaacaaggaatatgctccaggggaaaatctgcaacaatggcttactgatgctaaggca
cgagaccagtttgtgattcgtgctggttcagatacggaggttttgtggaatgatgcaaag
cttttaaagcccgaccctgtttataaacgtgctttttggacggagagttttgtacaatgg
tcacctttgggtacttacttggcaactgttcaccgtcagggggcagcagtttggggaggt
gctaccaccttcaaccgtctcatgcgttatgcacatcctcaggttaagcttattgatttt
tcacctggtgagaagtatttggtaacttatagcagccatgaaccaagcaatcctcgagat
gctaatagggttgtgatcaacatatttgatgtgaggactggtaaagtgatgagagatttt
aagggaagtgctgatgattttgctattggaggtactgggggtgtcactggagtgtcatgg
cctgttttcaaatggagcggtggaagagatgataagtactttgcaaggatgggaaaaaat
gtactgtctgtatatgagacagaaacattttctcttgttgacaaaaaatctttgaaggtt
gaaaatataatggatttcagctggtcaccgactgatccaatcatttcactgtttgttcct
gagacaggaggtggtaaccagcctgctagggtaagtcttgttcaaatccccagcaaagaa
gaactcaggcaaaagcttctttttaatgtcagtgactgcaagatgtactggcagagcaat
ggagaataccttgctgttaatgttgatcgatataccaaaacaaagaaaagcacattcaca
ggctttgagcttttccgtataaaggaacgtgacatacctattgaagttctggagctcgag
aataagaatgataagatcattgcatttgcttgggagccaaagggacatagatttgctgtt
attcatggtgataaccctaaacctgatattagtatctactcaatgcgaactgctcagaac
actggccgagtttcaaagctcactactctgaaaggcaagcaggcaaatgctttgttttgg
tcaccagcaggtcggttcattgtactagcagggttgaaaggtttcaatggactgttagaa
ttttacaatgttgatgagcttgaaaccatggctaatactgaacatttttatgcaactgat
gttgaatgggatccaactggaaggtatgttgcaactgctgtaacttcagttcatgaaatg
gaaaatggattcaatatatggtctttcaatggcaaacatctttatcggatattgaaggat
catttctttcagttcttatggagacccagaccagcttctttcttgactgctgagaaggag
gaagagattgcaaagaacttgaagaagtatagtaagaaatatgaagctgaagaccaagat
gtttcattgctgctgagtgagcaagagcgtgagaagcgtagggtcttgaaagaagattgg
gacaagtgggccaatgagtggaagctgttgcatgaagaagagaagctagagagggaaaat
ctgagggacggagaagctagtgacgaggaagaggaatatgaagccaaggacattgaagtt
gaggaagtagtcgatgttaccaaagagatccttcaagttgaggagtattag

DBGET integrated database retrieval system