KEGG   Medicago truncatula (barrel medic): MTR_3g107630Help
Entry
MTR_3g107630      CDS       T01716                                 

Definition
Acyl-protein thioesterase
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MTR_3g107630
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MTR_3g107630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 258 aa AA seqDB search
MSNRNFSASSGSGNASRTFEFGRTHVVRPKGKHQATIVWLHGIGDNGSSWSQLLETLPLP
NIKWICPTAPTRPVALFGGFPCTAWSDVGDISEDAPNDLEGLDASAAHVANLLSTEPPNI
ILGIGGFSNGAATALYSATCHVLGHYGNGNIYPINLSAIVSLSGWLPCSRTLRNQIGGSR
DGIRRATSLPLFIGHGSADDVVAYEHGENSARTLSSAGFQNLIFRSYNGLGHYTVPEETD
EVCRWLTANLALEGLRLN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagaaacttctcagctagttctggtagtggaaatgctagcaggacatttgag
tttggaaggactcatgtggttagacctaaagggaagcatcaagcaactattgtttggcta
catggtattggcgataacggctcgagctggtcccaactattggaaactcttcctcttcca
aatattaaatggatttgtccaactgctcctacgcggcctgtagccttatttggtggattt
ccttgcactgcttggtctgatgttggtgatatttcagaagacgctcctaatgatttggag
ggtttagatgcttctgcagcacatgttgccaatcttttgtcaacagagcctccaaatatc
atactcggtattggtggcttcagtaatggtgctgcaactgcactgtactcagctacatgt
catgttctgggacactatggaaatggaaacatttaccctattaacttaagcgcaattgtt
tcattaagtggctggcttccttgttcaaggaccttaagaaaccagatcggaggatcacgt
gatggtataaggcgtgcaacatcgttgcccttatttatcggccatggaagcgctgatgat
gtggttgcatatgaacatggagagaattctgcaaggaccttaagctcagctggattccag
aatcttatattcagaagctacaatgggttaggtcactatacagttcctgaagagactgat
gaagtttgcagatggctaactgcaaatttggcacttgaggggttaaggttgaactag

DBGET integrated database retrieval system