KEGG   Medicago truncatula (barrel medic): MTR_3g108660Help
Entry
MTR_3g108660      CDS       T01716                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1083 aa AA seqDB search
MSRPTTRSKNKRQKQGDDGVCTNETWRKIHETGVVTEDDVNQLYMIWKPVCSGCRVNTKD
NPNCFCGLVPPPNGSRKSGLWEKMSDFVESLGPDPNNDLRDSADSPAGLTNLGATCYANG
ILQCLYMNKLFREGIFSAEPDVLRQQPVLDQLARLFAQLQASKMAYIDSSPFVKTLELDN
GVQQDSHEFLTLLLSLLERCLSHSKVPKARTVVQDLFRGSVSHVTTCSQCGRDSEASSKM
EDFYELELNVKGLKSLDESLDDYLAVEELHGDNQYFCDSCNTRVDATRSIKLCTLPDVLN
FQLKRCVFLPKTTTKKKITSAFSFPAQLDMQHRLPELSQFDLVYDLSAVLIHKGTGVNSG
HYIAHIKDKNTGQWWEFDDEHVTNLGNHPFGEGSSSSTTKSIAIDAIHSDCSEARIAESN
GNGFHTTHSQSSLIETFSSCDAYMLMYHLRHTKGIKENGGIVCGASHKEIEGVVATAQDD
ASLPSHLYDEICNVNASYLDACQQYSHRKELELSRITDRRHEVRSILAEAPVPPLERPFY
WISSDWLRQWADNIIPTSIDNTSIQCSHGKVPVSKVPSIKRLSVKAWDKLFSKYGGIPTL
SHDDHCRDCLICGAQTVVSADTYRGRRESLKSLARDILDGNCLDGKYFISRPWLQQWWKR
KVLDAPSEADAGLTAAINCPHGLLMPEQAPGAKRVLIPETFWLFLYEDAISVKPDDPVGG
PALPSDSLECSQCTVELSQAACLEDSLRVVKQKQRQNHEKLFQAKSMPLSVNCKYFLVAS
SWISKWRNYISPPFKNLDKPETLDGVIDSLICEKHSRLIERPPELVFRRGAIIQRESSAG
GLTIISENDWICFCEEWGGSETKGISATIDYINDSDNLLTGSCDEMLICEDQSHTEDKMN
NENGTGQILIKTCPEVCESCIGEKESCELMHKLNYCNEDICVILVRGKEVPKSILEASKG
LVETDRRISKRSRKTKNGSSVSLKVSASTSLYQLKMMIWESFGVVKENQILHKGDRIIDM
DDECATLADANIFARDQIIVRDSEIHENRDIADELCCDKMDVQHTEEGFRGTLLTANISS
QVV
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaccgacgactcggagtaaaaataaaagacaaaaacagggtgatgatggtgtc
tgtactaatgaaacatggaggaaaattcacgaaaccggtgtggttactgaagatgatgtt
aatcagttgtatatgatttggaaaccggtttgttcaggctgccgtgtcaataccaaagat
aaccctaattgcttttgtggattggttccacctccaaatggatccaggaagtcaggctta
tgggagaagatgtcagattttgttgaaagtcttggccctgatccaaacaatgatcttcgt
gattctgctgattctcctgcaggtctaacaaatcttggggcaacgtgttatgccaatgga
atacttcaatgcttgtacatgaacaaattattccgagaaggcatattttctgcagaacca
gatgttttaaggcaacaaccggtgttagatcaactagctcgactttttgcgcagttacaa
gctagtaaaatggcttatatagattcttctccctttgtgaaaacactggagttagataat
ggagttcagcaggatagccacgaattcttgacattgcttctgtcattgcttgagcgttgt
ctgagtcattccaaagttcccaaggcaagaacagtagttcaagatcttttccgcggaagt
gtatctcatgtgacaacgtgctcacaatgtggaagagactctgaagcttcttccaaaatg
gaagatttttatgagttagagttgaatgtgaagggattgaaaagtttagatgagagtcta
gatgattacctagctgttgaagagcttcatggagacaatcaatatttttgtgattcatgc
aacacaagagttgatgccactcgcagcatcaagctgtgtacattacctgatgtacttaat
tttcaacttaaacgttgtgtctttcttccaaagactactacaaagaagaaaattacttct
gcattttcatttcctgcacaacttgatatgcagcacagactgcctgagttgtctcagttt
gatttggtatatgacttgtcagctgtactgattcacaagggaaccggtgttaatagtggc
cattacattgcccacatcaaggacaaaaacacggggcagtggtgggaatttgatgatgag
catgttactaatttgggtaaccatccatttggcgaaggatcttctagttctactactaag
tccattgcaattgatgcaattcactctgactgctctgaagcaaggatagctgaaagtaat
ggaaacggcttccacaccacccattcacaatcttcgcttatagagacattttcttcttgt
gatgcatacatgttgatgtaccatcttagacatactaaaggtataaaggaaaatgggggc
atagtttgcggtgctagccataaagaaatagagggtgttgtagctactgcacaagatgat
gcttctcttccttctcatctttatgatgagatttgcaatgtcaacgcctcatatcttgat
gcttgtcaacaatacagtcataggaaagagttagaattgagtcgtattactgataggaga
catgaagttcgatctattttagctgaagctcctgttccaccattggagcgaccgttttat
tggatttctagtgactggcttcgccagtgggctgacaacattattccaacttctatcgac
aacacatccatccaatgttcacatgggaaagtcccagtttcaaaggttccctcaataaag
cgactgtctgtcaaagcctgggataagttgttctccaagtatggtgggattccaacacta
tctcatgatgaccattgtcgggattgtctgatatgcggggctcagacagtggtatcagcc
gacacctatcgcggtagaagagaatcattgaagtcacttgcacgggatattcttgatggg
aactgtctagatggaaagtatttcatatccagaccatggttgcagcagtggtggaaaaga
aaagttcttgatgctccatctgaagctgatgctggactaacagcagcaattaattgtccg
cacggtctattgatgccagagcaagctcctggtgcaaagcgggtgcttattcctgagact
ttttggctcttcttatacgaagatgctatttctgtaaaacctgatgatcctgtaggtggc
ccagctcttccttcagattccctagagtgttctcaatgcactgttgaattatctcaagca
gcatgcttggaggactccttgagagtagttaaacaaaagcagcgtcagaatcatgagaaa
ttattccaggctaaaagcatgccactctctgtgaattgcaaatatttcttggtggcttct
tcatggatttctaaatggagaaattacattagtccaccattcaagaatctagataaacct
gaaactttagatggggtaattgattcgctgatttgtgaaaagcactcacgacttattgaa
agacctcctgaactggttttcagacgcggtgctataatccagagagaatcttcggcaggt
ggcttaaccatcatatctgagaatgattggatatgcttctgtgaagaatggggtggttct
gagaccaaaggaatatcagcaacaattgattatattaatgattcagataacttattgact
ggatcctgcgacgagatgctgatatgtgaggatcagtcacacacggaggataaaatgaat
aatgaaaatggaactggacaaattttgatcaagacctgtcctgaggtctgtgaaagttgc
attggagaaaaagaaagctgtgaattaatgcataaacttaactattgcaatgaggacata
tgtgtaattcttgtacgtggtaaggaggtacctaaatcaatattggaggcctcaaaggga
ttagttgaaacagatcggcggatttccaagcgctcccggaagactaaaaatggaagttcg
gttagtctgaaagtttctgcttccacatcactataccagctgaagatgatgatatgggag
tcctttggggttgtcaaggaaaaccagatcctacataaaggtgataggataattgatatg
gatgatgaatgtgctacccttgcggatgcaaatatatttgccagagatcagattatagtg
agggattctgagatccatgaaaatcgagatattgcagatgagctctgctgtgataagatg
gatgtgcagcatacggaggaaggttttcgtggaacacttcttacagcaaacatttcatcc
caggttgtctaa

DBGET integrated database retrieval system