KEGG   Medicago truncatula (barrel medic): MTR_3g117080Help
Entry
MTR_3g117080      CDS       T01716                                 

Definition
Dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mtr00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mtr00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 569 aa AA seqDB search
MYIVYYTMYVIENIALHFQKNWLCSPYFHPNQSLSLCRRFLSSTMAGDSSAIFNGNGNGS
INLQRTYQVVVAATKEMGIGKDGKLPWRLPTDLKFFKEITTTTSEPGKKNAIVMGRKTWE
SIPLQFRPLLGRLNVVLTRSGTFDIAAAENVVICRSMSSALELLAASPYHTSIEKIFVIG
GGEIFREALNAPECEAIHLTEIQSNIECDTFMPPIDTTIFQPWYSSFTKVENNIRYSFTT
YVRVRSSAAEYPKNTDSFFDSNSASKKFEVQNFSFLPKMIFERHAEYMYLNLVQEIISQG
TTKGDRTGTGTLSAFGCQMRFNLRRGFPLLTTKRVFWRGVVEELLWFISGSTNAKVLQQK
GIHIWDDNASREFLDSIGLSEREEGDLGPVYGFQWRHFGAKYTNMHGDYANQGLDQLLDV
INKIKHNPDDRRIILSAWNPADLKLMALPPCHMFAQFYVANGELSCQMYQRSADMGLGVP
FNIASYALLTCMIAHICELVPGDFIHAIGDAHVYQTHVRPLQEQLHNLPKPFPTLKINPK
KKDIDSFVATDFKLIDYDPHQKIEMKMAV
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtatattgtatactatactatgtatgtaattgaaaatattgcactgcacttccaaaag
aattggttgtgcagtccttattttcatccgaaccaatctttaagtctgtgtcgtcggttt
cttagttctactatggctggtgattcctctgcaatcttcaatggaaatggcaatggcagc
atcaacctacagaggacttaccaagtagttgtggctgccaccaaagaaatgggcattggt
aaggatgggaaattaccatggagactacctaccgatctcaagtttttcaaggagataact
actacaacatccgagcctgggaagaaaaatgccattgttatgggaagaaaaacatgggag
agtatccctcttcaattcagacctcttcttggtcgtcttaatgttgttttgactcgctcg
ggtacctttgatattgcagcagcagaaaatgttgttatatgtagaagtatgtcgtctgcg
ttggaactcttagcagcttctccttatcacacttcgattgagaaaatatttgttataggg
ggtggtgagatatttagggaggctctcaatgcacctgaatgtgaagctatccacctcaca
gaaattcaatcaaacattgagtgtgatacttttatgcctccaattgacaccactatattt
cagccatggtactcgtccttcactaaggtggaaaacaacatccgatattcattcaccact
tatgtgcgtgtaaggagttctgcagcagagtacccgaagaatactgattctttctttgat
agtaattcggcttctaaaaaatttgaggttcagaacttttcttttcttccgaaaatgatt
ttcgagagacatgcggagtacatgtatcttaatctggttcaagaaatcatatctcaaggt
accactaagggtgataggacagggactgggaccttgtcagcatttggttgccagatgagg
ttcaatctgcgcagaggctttcctcttctaacaactaagagagtattttggcgaggggtt
gttgaagagcttctttggtttatcagcggctcaacaaatgccaaggtgttgcagcaaaaa
ggcattcatatatgggatgataatgcatccagggagttccttgacagcattggtttgtca
gagagggaagagggtgatttaggacctgtttatgggtttcagtggaggcactttggtgcc
aagtatactaacatgcatggtgactatgccaaccaaggacttgatcagcttttagatgtt
atcaacaagataaagcataatcccgatgatcgacggatcattctctctgcatggaatcca
gcagatcttaaattgatggctcttccaccctgccacatgtttgcacagttctatgtagca
aatggggagttatcatgtcaaatgtatcagcgatctgctgacatgggcctgggtgtgcca
tttaacattgcttcttatgccctcctgacatgcatgattgctcatatttgtgaacttgtt
ccaggtgattttatccatgctattggggatgcacatgtgtaccaaactcatgtgaggcct
ttgcaggagcagcttcataacctaccaaaaccttttccaactttgaagatcaatccaaag
aagaaagatatagattcttttgtggctactgatttcaagctcattgactatgatcctcac
cagaagattgagatgaaaatggctgtttaa

DBGET integrated database retrieval system