KEGG   Medicago truncatula (barrel medic): MTR_3g117500Help
Entry
MTR_3g117500      CDS       T01716                                 

Definition
Endo-1 4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 487 aa AA seqDB search
MALAKLLLFVLLLAIGERSVNAHDYAEALSKAIMFFEGQRSGFLPEDQRQKWRANSGLSD
GWTYNTDLTGGYYDAGDNIKFGFPMAFTTTMLSWSVIEFGENMPPNELRNALVAIRWSTD
YLLKTVSQSNRIFVQVGDPISDHNCWERPEDMDTNRKVYAVDAPNPASDVAGETAAALAA
SSMAFRSSDPGYSETLLRNAVKAFQYADSYRGAYSDNADVKDGVCPYYCDFDGYQDELLW
GAAWLRRATQDENYLNYIQSNGKTLGAEDNINEFGWDNKHAGLNVLVSKEVLDGNVESLE
SYKTSAESFLCTLLPETSSSHIEYTPGGLIYRPGGSNLQHATSIAFLELVYAKYLSRTSQ
TINCGNVYVSAQTLRERAKRQVDYILGDNPLGLSYMVGYGNNYPQRIHHRGSSLPSIKDH
PQQIACKEGSIYFNSTNPNPNVLVGAIVGGPGEDDVYVDDRADYRKSEPTTYINAPFVGV
LAYFVAN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcattggccaaattgttgttgtttgttctactactggcaattggagaaagaagtgtg
aacgcacatgattatgcagaggcattatcaaaggcaataatgttctttgagggacaacga
tcggggtttttaccagaggaccagagacagaagtggcgtgcgaattcaggtttgagtgat
gggtggacttacaacactgatcttactggcggttactacgacgccggtgataacatcaag
tttgggtttccgatggcgtttacgacgacaatgttgtcatggagtgtgattgagtttggt
gaaaacatgcctcctaatgaactcagaaacgctttggtcgcaattcgttggagtactgat
tatttgcttaagactgtttctcagtctaaccgcatttttgttcaggtgggtgacccaatc
tcagaccacaactgttgggagaggccagaagacatggacacaaacaggaaagtgtatgct
gttgatgcacctaacccagcttccgatgtcgccggtgaaactgcagccgcacttgctgct
tcttcgatggcattccggtcatcggatcccggttattcagagacattactaagaaatgct
gttaaggcatttcaatatgcagatagttacaggggcgcatacagtgacaatgctgatgtt
aaggatggtgtctgtccttattattgtgattttgatggataccaggacgaattgttatgg
ggtgccgcatggttaaggagggctactcaggatgaaaattacctaaactacattcaaagc
aatggtaaaacacttggtgctgaagacaacatcaatgagttcggttgggacaacaagcat
gctggcctcaacgttcttgtctccaaggaagtcctagatggaaatgttgaatctcttgaa
tcttacaagacctcggcagagagcttcctgtgcacattactacctgaaacatcaagttca
cacatcgagtacactcctggtggactcatatacagaccaggtggaagcaacttacaacat
gcaacttcaattgctttccttgagttagtctacgccaaatacttatcccgcacgtcacaa
accatcaattgtggcaatgtttatgttagtgcacaaacacttcgggagcgcgccaagaga
caagttgattacattttaggtgataaccccttgggtttatcttacatggttggttatggt
aacaactatccacaacgtattcatcaccgtggctcatctctaccttctattaaggaccat
cctcaacagattgcttgcaaggaaggttcaatatacttcaattcaacaaatcctaaccca
aatgttcttgtaggagctattgtgggaggacctggagaagatgatgtttatgtggatgac
agggctgattatagaaaatctgagccaactacatatattaatgcgccatttgttggggtt
ttagcatattttgttgctaattaa

DBGET integrated database retrieval system