KEGG   Medicago truncatula (barrel medic): MTR_4g005050Help
Entry
MTR_4g005050      CDS       T01716                                 

Definition
Histone acetyltransferase
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MTR_4g005050
Transcription factors [BR:mtr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    MTR_4g005050
Mitochondrial biogenesis [BR:mtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    MTR_4g005050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1723 aa AA seqDB search
MKLNQAGSQLPGLAQLNGNGQMPSLGGVSRSALNMDPEFPRAREFIQEKICETLFRRHQQ
PISEIQKRRIKDLAKRLEEGMLKNAPSKEEYMNLETLEARLSLFLRQATMNNRSQQYPQL
VSSSPIGTMIPTPGMSHGPNSNVVVASSIDASMISSSGGNSVVSTTFNGVNILPTGGIHG
SSLNRSDGLSNGYQQSSTSFSAGSVGNMSSMSVPRTSSQMIPTPGYTVNSNHSHMNVDSS
TNGNVFSSAESTMVPLSQLQQQKQHVGDQSQVLPNIGSQMSSGMRSGLLHKQFTNSNGAV
NSGLGLIGNNIQLPNEPVTSDGYASTYANSPKHIHQHFDQNQKPVMQGDGYGLNNVDPFA
SGNFYASATSSGSMMNTRNTNSVQLPSIPKTSSLISGHSNLHGMQQSAHIKSEAINQLEK
LNFQSSSTSRDALLHSQQQYQQRPHQFQQSEQYPQSQQQFQLKLHSQQPRHLVNDNAFNQ
SQLSSNLENQVKSEPGIEHHKEVLSSHVPEQFHMSEIQNQFQQNSSEDCSRAQYLSFPSG
QHNLSSSVPQSSQQMLHPHHLVAESQNKFSCLTVEAQCNSKQWTDSQDGNPMSNNSSHDH
HLHVDFHQRISGKDEAHCNNLSSDVSMGQAVAPRGAAEPLDPGSTTKNAHRNQQRWLLFL
LHARRCSAPEGRCQERFCSFAQKLCRHMDGCNLRHCPYPRCHHTKELFHHFIHCKDPCCP
VCVFVKKCRRACQLKAQSQPPSESSLPSVVNGSCKSYNITATSSRLISKPTLVVETSEDL
HPSVKRIKIEHSTQSVNLEKDNSASSVSANCDSVVSRDAQSQTYPNAEKSISIKSEITEV
KAEVLAHAKLSEMKMDSSNADDKIPDGEPVKNDDTGNLARPENMKTEKEVGQDKQEHVMQ
PGENAAGTKSGKPKIKGVSLTELFTPEQVREHITGLRQWVGQSKSKAEKNQAMEHSMSEN
SCQLCAVEKLTFEPPPIYCTTCGVRIKRNNMYYTMGTGDTRHYFCIPCYNDARSEHIVVD
GTPIAKSRLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPNCYIEE
VERGERMPLPQSAVLGAKDLPRTILSDHIEQRLFKRLKHERQERARFHGKSYDEVINILV
VPGADSLVVRVVSSVDKKLEVKQRFLEIFQEENYPTEFPYKSKVVLLFQKIEGVEVCLFG
MYVQEFGAESQFPNQRRVYLSYLDSVKYFRPEIKSVTGEALRTFVYHEILIGYLEYCKLR
GFTSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWLAQEIQYKYLAMLKKAAKENVV
VNITNLYDHFFTSTGECRAKVTAARLPYFDGDYWPGAAEDLIYQLRQEEDGRKQNKKGTT
KKTITKRALKASGHSDLSGNASKDLLLMHKLGETISPMKEDFIMVHLQHACTHCCILMVC
GNRWVCNQCQNFEICDKCYEAELKREERERHPINQREKHSLYPVEITDVPFDTKDKDDIL
ESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICYLDIET
GQGWRCEVCPEYDVCNSCYQKGGIDHPHKLTNHPSVADRDAQNKEARQVRVLQLRKMLDL
LVHASQCRSPHCQYPNCRKVKGLFRHGMHCKTRASGGCVLCKKMWYLLQLHARACKESEC
HVPRCRDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEVANNAG
NT seq 5172 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatcaagcaggttctcagttacctggactagcccaactcaatgggaacgga
cagatgccatctttaggcggtgtttcacgatcagcacttaatatggaccctgaatttcct
agagcacgcgagtttattcaagagaagatctgtgagacgttatttcgacggcatcagcag
ccaattagtgaaattcaaaaaaggaggattaaggatcttgcaaaacgcctggaggagggc
atgttaaaaaatgctccttctaaggaggagtacatgaacttggaaacactagaggctcgt
ttatctcttttcctccgacaagcaactatgaataatcgcagccaacagtatccccagctt
gttagctcgtctcctattggtacaatgattccaacccctggtatgtcgcatggtccaaat
tcaaacgtggttgttgcatcttctatagatgcctcaatgatttcttccagtggtggtaat
agtgtagtatcaacaactttcaatggtgtaaatatattaccaactggtggcatacatgga
agctccttaaatagatctgatggtttatcaaatggatatcaacagtcttctaccagcttt
tctgctggctcagtggggaacatgtcatcaatgagtgtgccgagaacttcaagccagatg
attcctacgccgggatatacagtcaacagcaatcactcacatatgaatgtagattcatct
actaatggtaatgtcttctccagtgcagagtctactatggtaccactgtcacagcttcaa
cagcagaaacagcatgttggtgaccaaagccaggtattgccgaacattggcagccaaatg
agtagtggaatgagatctggtttgctacataaacagtttacaaactcaaatggtgctgtg
aatagtgggctaggcctgattggtaacaatattcaactcccaaatgaaccagtcacctcc
gatggctatgcttcaacttatgctaattcccctaaacacatacatcagcactttgatcaa
aatcagaaaccagtaatgcagggtgatggatacggattgaataatgttgacccttttgct
tctggaaacttttatgcatctgcaacatcttctgggtctatgatgaacactcggaacaca
aattcagtacaattgccatcaatacccaaaactagctcgttgatcagcggtcactcaaat
ttgcatggtatgcagcagtctgctcacataaagtctgaagcaatcaaccaattggaaaag
ttgaattttcagtcttcatcaacttcaagagatgcccttctgcattctcaacagcagtat
cagcaaaggccccatcaatttcaacagtcagagcagtatcctcaatcacagcaacaattt
caattgaaactacatagtcaacagcctcggcatttggtcaatgataatgctttcaatcag
tctcagttgtcttccaatctagaaaaccaagtgaagtcagagcctggaattgagcatcat
aaagaagtgctcagttctcatgttcctgaacagttccacatgtctgagatacagaatcag
ttccagcagaactcatctgaagattgctctagagctcaatacctttcctttccatctggt
cagcataatttatcctcatcagtacctcaaagttcgcaacaaatgttgcatccacaccat
ttggttgcagaatctcaaaataagttcagctgtcttacagttgaggctcaatgcaattcc
aaacaatggactgactcacaagatggtaacccaatgtctaacaatagttcacacgaccat
catctccatgtggattttcatcaaagaatatcaggaaaggatgaagctcattgcaataat
ttatcatcagatgtatctatgggccaagccgttgctcctaggggtgcagctgagccgcta
gacccaggaagtactaccaaaaatgcacacaggaatcaacaacggtggcttttatttcta
cttcatgctcgacgatgttctgctcctgaaggacgatgccaagaacgcttttgttctttt
gcacagaagctatgtaggcacatggatggatgcaacctgcgccattgtccgtaccctcgt
tgtcatcatactaaggaattgtttcatcattttatacactgcaaggatccatgttgccct
gtttgtgtttttgtaaaaaaatgccggcgggcatgtcaacttaaggctcagagtcagcca
ccatctgaatcgagtttgccaagtgtggtaaatgggtcctgtaaatcttacaatattacc
gccacgtcatcaagattgatctcaaaacccacattagttgtggaaacatcagaagacctg
cacccatctgtaaaacgcataaagattgagcattccactcagtctgttaatcttgaaaag
gacaactctgcttcttctgtttctgcaaattgtgattctgtagtttccagggacgctcag
tcccaaacatatcccaatgcggagaagtctatctcaattaaatctgagattacagaagta
aaagcagaagttttggctcatgccaagcttagtgaaatgaagatggattcgagtaatgca
gatgataaaattcctgatggtgagcctgtgaagaatgatgatactggtaatttagctagg
ccagaaaatatgaaaactgagaaagaagttgggcaagataagcaagaacatgtgatgcag
ccaggtgaaaatgcagctggaacaaagtctggtaagccaaaaataaaaggggtctcttta
accgaattatttactccagagcaagtcagggaacatattactggtctcaggcaatgggtt
ggccaaagcaaatcaaaggcagagaagaatcaagcaatggagcactctatgagtgagaat
tcctgtcaattatgtgctgtggagaagcttacgtttgaaccaccacctatttattgcacg
acatgtggggttcgcatcaaacgtaacaatatgtactataccatgggtactggtgatact
cgacattatttttgcatcccatgctataatgatgctcgttctgaacacatcgttgttgac
gggactcccattgccaagtcaagattggaaaagaagaagaatgatgaggaaactgaggaa
tggtgggttcaatgtgataaatgtgaagcttggcaacaccaaatatgtgccttgtttaat
ggtagaagaaatgatggtggacaagctgaatacacttgccctaactgctacattgaagag
gtagaacgaggagagcgcatgccattaccccaaagtgctgttcttggagccaaggattta
ccgagaactattcttagcgaccatatagaacaacgattatttaagcggctaaagcacgaa
agacaagagagagcaagatttcatgggaaaagctatgatgaggtgattaatatactggtt
gttcctggagctgattcccttgttgtaagagttgtatcatctgttgacaagaagttagaa
gtgaaacagcgatttttggagatttttcaggaagaaaattacccaacagaattcccatat
aaatcaaaggtagttttgttgtttcaaaagattgaaggtgtggaagtatgcctatttggc
atgtatgttcaagaatttggagctgaaagtcaatttcccaatcagcgtcgggtgtatctt
tcatatttggactccgtgaagtatttcaggcccgagattaaatcagtaactggagaggct
cttcgaacatttgtttaccatgaaattctgattgggtaccttgaatattgtaagctccgt
ggttttaccagctgctatatatgggcttgtcctccgctgaagggtgaagattatattttg
tattgccatccagaaattcagaaaacaccaaaatctgataagcttcgtgaatggttagca
caagagattcaatataagtatctagccatgttaaaaaaagctgcgaaggagaatgttgtg
gtcaatatcaccaacttatatgatcatttcttcacatccaccggtgaatgtagggctaag
gttacagctgcaagactcccatattttgatggtgactactggcctggggctgcagaagat
ttgatttatcagctacgccaagaggaagatggaagaaaacaaaataaaaaaggaacaacc
aaaaaaactatcacaaaaagggctttaaaagcatctggtcattcagatctttcaggaaat
gcatcaaaagatctgctcctcatgcacaaacttggtgaaaccatttccccaatgaaggaa
gattttattatggttcatttgcagcatgcatgtacccactgctgcattctaatggtgtgt
ggcaaccgctgggtttgtaatcagtgccagaactttgagatttgtgataagtgttatgaa
gcagagctaaaacgtgaagagagagaaagacatcctattaatcagagggaaaaacacagt
ctttatccagttgaaattactgatgtaccatttgatacaaaggataaagatgatattctt
gagagtgaattctttgacactagacaggcatttctgagtctctgccagggaaatcattat
cagtatgatacactaaggcgggccaagcattcctcaatgatggtcctatatcatcttcat
aatccaactgctcctgcatttgtgaccacttgtaatatatgctatcttgacatagaaact
ggtcaaggttggcgttgtgaagtttgccctgagtacgacgtatgcaattcttgttatcag
aagggaggcattgatcatcctcataagttgacaaatcatccgtcagtggcggatcgtgat
gctcagaacaaagaagcaagacaagttcgagtattgcagctaaggaaaatgcttgatctt
ctagtgcatgcatcccaatgtcgttctccacattgccaatatcctaattgtcgcaaagtg
aagggcctcttccgccatggtatgcactgcaaaacacgtgcttctggaggctgtgttctt
tgcaagaaaatgtggtatttgcttcaacttcatgctcgtgcatgcaaagaatccgaatgc
catgtgccacgatgcagagatttaaaagaacatctaaggaggctgcagcaacagtctgat
tcacgacgtagagctgctgtaatggaaatgatgaggcaaagagctgcagaagttgctaac
aatgctggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system