KEGG   Medicago truncatula (barrel medic): MTR_4g005830Help
Entry
MTR_4g005830      CDS       T01716                                 

Definition
Mitogen-activated protein kinase kinase
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:mtr04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 366 aa AA seqDB search
MRPIQLPPPTSTGSATASGSPNNNNSRPQRRRRDHLTLPLPQRDTNLAVPLPLPPSGGSG
GGGNGSGSGSGGASQQLVIPFSELERLNRIGSGSGGTVYKVVHRINGRAYALKVIYGHHE
ESVRRQIHREIQILRDVDDVNVVKCHEMYDHNAEIQVLLEYMDGGSLEGKHIPQENQLAD
VARQILRGLAYLHRRHIVHRDIKPSNLLINSRKQVKIADFGVGRILNQTMDPCNSSVGTI
AYMSPERINTDINDGQYDAYAGDIWSLGVSILEFYMGRFPFAVGRQGDWASLMCAICMSQ
PPEAPTTASPEFRDFVSRCLQRDPSRRWTASRLLSHPFLVRNGSNHNQSPPNMHQLLPPP
PRSQSS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgattcagcttccaccaccaacctccaccggttcagccaccgcttccggttca
ccaaacaacaacaacagccgccctcaacgccgccgcagagatcacctaactctaccgctt
cctcagcgtgacactaacctcgctgttccacttccgctgccaccatctggtggcagcggt
ggtggaggaaacggaagcggtagcggaagcggaggagcaagtcaacagctagtgattccg
ttttccgagctagaaagattgaaccggatcggaagtggaagtggaggaacggtttacaaa
gtagttcacagaatcaacggtcgtgcttatgctttgaaggtgatatacggacatcacgag
gaatcagttcgtcgtcagatccatcgtgaaatccagatcttgcgtgatgttgatgatgtt
aacgtcgtcaagtgtcatgagatgtacgatcacaacgctgagattcaggttttgcttgaa
tacatggacggtggatctctcgaagggaaacatattccgcaggaaaatcaacttgctgac
gtggcacgtcagatcctccgtggactcgcgtatctccaccgtcgtcacatcgttcatcgt
gatatcaaaccgtcgaatctcttgataaattcacggaaacaggtgaagattgctgatttt
ggtgtaggaagaattctgaatcaaacgatggatccgtgtaattcatcggtaggaacaatt
gcttacatgtcaccggagaggataaacaccgatatcaacgatggacaatatgatgcatac
gcaggtgatatatggagtttaggtgtgagtatattggagttttatatgggaaggtttcca
tttgcggttggtagacaaggtgattgggcgagtttgatgtgtgcaatttgtatgtcacaa
ccaccagaagctccaacgactgcttcaccggagttcagggatttcgtttctaggtgtttg
cagagagatccgtcgaggagatggactgcttcgaggttgctttcacatccttttcttgtg
agaaatggttctaatcataatcagagtcctccaaatatgcatcagttacttcctccacca
ccaagatcacaatcttcttag

DBGET integrated database retrieval system