KEGG   Medicago truncatula (barrel medic): MTR_4g005830Help
Entry
MTR_4g005830      CDS       T01716                                 

Definition
(RefSeq) MAP kinase kinase
  KO
K13413  mitogen-activated protein kinase kinase 4/5 [EC:2.7.12.2]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr04016  MAPK signaling pathway - plant
mtr04075  Plant hormone signal transduction
mtr04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    MTR_4g005830
   04075 Plant hormone signal transduction
    MTR_4g005830
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    MTR_4g005830
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MTR_4g005830
Protein kinases [BR:mtr01001]
 Serine/threonine kinases: STE group
  STE7 family
   MTR_4g005830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like FTA2 RIO1 Haspin_kinase Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 11420464
NCBI-ProteinID: XP_003604135
UniProt: G7JVJ5
Position
4
AA seq 366 aa AA seqDB search
MRPIQLPPPTSTGSATASGSPNNNNSRPQRRRRDHLTLPLPQRDTNLAVPLPLPPSGGSG
GGGNGSGSGSGGASQQLVIPFSELERLNRIGSGSGGTVYKVVHRINGRAYALKVIYGHHE
ESVRRQIHREIQILRDVDDVNVVKCHEMYDHNAEIQVLLEYMDGGSLEGKHIPQENQLAD
VARQILRGLAYLHRRHIVHRDIKPSNLLINSRKQVKIADFGVGRILNQTMDPCNSSVGTI
AYMSPERINTDINDGQYDAYAGDIWSLGVSILEFYMGRFPFAVGRQGDWASLMCAICMSQ
PPEAPTTASPEFRDFVSRCLQRDPSRRWTASRLLSHPFLVRNGSNHNQSPPNMHQLLPPP
PRSQSS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgattcagcttccaccaccaacctccaccggttcagccaccgcttccggttca
ccaaacaacaacaacagccgccctcaacgccgccgcagagatcacctaactctaccgctt
cctcagcgtgacactaacctcgctgttccacttccgctgccaccatctggtggcagcggt
ggtggaggaaacggaagcggtagcggaagcggaggagcaagtcaacagctagtgattccg
ttttccgagctagaaagattgaaccggatcggaagtggaagtggaggaacggtttacaaa
gtagttcacagaatcaacggtcgtgcttatgctttgaaggtgatatacggacatcacgag
gaatcagttcgtcgtcagatccatcgtgaaatccagatcttgcgtgatgttgatgatgtt
aacgtcgtcaagtgtcatgagatgtacgatcacaacgctgagattcaggttttgcttgaa
tacatggacggtggatctctcgaagggaaacatattccgcaggaaaatcaacttgctgac
gtggcacgtcagatcctccgtggactcgcgtatctccaccgtcgtcacatcgttcatcgt
gatatcaaaccgtcgaatctcttgataaattcacggaaacaggtgaagattgctgatttt
ggtgtaggaagaattctgaatcaaacgatggatccgtgtaattcatcggtaggaacaatt
gcttacatgtcaccggagaggataaacaccgatatcaacgatggacaatatgatgcatac
gcaggtgatatatggagtttaggtgtgagtatattggagttttatatgggaaggtttcca
tttgcggttggtagacaaggtgattgggcgagtttgatgtgtgcaatttgtatgtcacaa
ccaccagaagctccaacgactgcttcaccggagttcagggatttcgtttctaggtgtttg
cagagagatccgtcgaggagatggactgcttcgaggttgctttcacatccttttcttgtg
agaaatggttctaatcataatcagagtcctccaaatatgcatcagttacttcctccacca
ccaagatcacaatcttcttag

DBGET integrated database retrieval system