KEGG   Medicago truncatula (barrel medic): MTR_4g005860Help
Entry
MTR_4g005860      CDS       T01716                                 

Definition
Mandelonitrile lyase
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    MTR_4g005860
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     MTR_4g005860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 567 aa AA seqDB search
MEASSITVSLQFLLLLFFTTIFFPSSFASQQQDKPPSYLKMVANASEFPLEDYYDYIIVG
GGTAGCPLAATLSQSHRVLILERGGVIHGKLNLMNQEGFLNTLLSATANNANNEDSPAQS
FVSEDGVLNARGRVLGGSSAINAGFYSRADCEFFTKSGLNWDLKLVNESYEWVEREIVFR
PDLKTWQSAVRDGLLEAGVGPYNGFTLDHATGTKIGGSTFDSQGKRHSSADLLRYARHSN
LRIAVYASVERLLLASSSSSFAPNSATGSSVIGVLYRDQNGRYHHAMLKDFGEVILSAGA
IGSPQLLLLSGIGPRPYLSSWGIPVAHHLPYVGHFLYDNPRNGITILPSVPLEHSLIQVV
GITNSGAYIEAASNVVPFLSPPQTAFIRSSASPLYLTVGTLISKISGPVSAGFLRLASTD
VRFNPIVRFNYFSNGVDVEKCVNGTRKLGDVLRSRAMNDFKFRNWLGVRDFRFIGPALPN
DQTDYAEMADFCKRTVSTIWHYHGGCVVGRVVNRHLKVIGIDSLRIVDGSVFSVSPGTNP
QATLMMLGRYFGLKIIREREGKGTHEL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttcatccataaccgtttccttacagtttctattactcttatttttcaccaca
attttctttccctcttccttcgcttctcaacaacaagacaagccaccgagttacctaaaa
atggttgcaaacgcaagcgagtttccgttagaagattactacgactacataatcgtcggt
ggcggaaccgccggttgtccattagccgccacactctcccaatcccaccgcgttctcatc
ctcgaacgcggcggagtcatccatggaaaactcaacctaatgaaccaagaaggtttcttg
aacacactcttgagcgctaccgcaaacaacgccaacaacgaagattcaccggcgcaatct
ttcgtttctgaagacggtgttctcaatgctcgtggccgtgttcttggtggtagtagtgcg
attaacgcagggttttatagtcgtgctgattgtgaattctttacgaaatctggtcttaat
tgggatttgaaacttgtgaatgaatcgtatgaatgggttgaacgtgaaatcgtgtttcgt
cctgatttgaaaacgtggcaatccgctgttcgtgatggtcttcttgaagctggtgttggt
ccttataacggtttcaccttagatcatgctactggtaccaaaatcggtggatccaccttc
gattcccaaggtaaacgacatagttctgcggatcttttacgatatgcgcgacattccaat
ctcagaatcgccgtttatgctagcgtggaaagactccttctagcatcttcttcatcttct
tttgcaccaaattctgcaacaggttcttctgttattggtgttctttatcgtgatcaaaac
ggtagatatcatcatgcgatgttgaaagattttggtgaagtgatactttcagcaggtgca
attggaagtccacagcttcttcttctcagtggaattggacctagaccttatctttcttca
tggggaattccagtggcacatcatttaccttatgtaggtcattttctatatgataatcca
cgtaatggaatcacgattctaccttctgttccgcttgaacattcgcttatacaagttgta
gggataacaaattcaggtgcttatatagaagctgcttctaatgttgttccgtttttgtca
ccaccgcaaactgctttcatccgttcgagtgcttctccgctttatctgacagttggaaca
ctgatttcaaagatttcaggaccggtttctgctggttttctacgattggcttcgactgat
gttaggtttaatcctattgttaggtttaattactttagcaatggtgttgatgttgagaaa
tgtgttaatgggaccagaaaattaggggatgtacttcggagcagagctatgaatgatttt
aagtttaggaattggttaggtgtgagggattttaggtttattggacctgctttgcctaat
gatcaaacggattatgctgaaatggctgatttttgtaaaaggactgttagtactatatgg
cattatcatggtggatgtgttgttggtagggttgttaatcgtcatcttaaggtcattgga
attgattctcttagaattgtggatggttctgtttttagtgtttcacctggaactaatcct
caggctacactaatgatgcttggaaggtattttgggctgaagataatcagagaaagggaa
gggaagggtacacatgagttgtga

DBGET integrated database retrieval system