KEGG   Medicago truncatula (barrel medic): MTR_4g009920Help
Entry
MTR_4g009920      CDS       T01716                                 

Definition
Glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MTR_4g009920
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    MTR_4g009920
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MTR_4g009920
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTR_4g009920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 519 aa AA seqDB search
MSKEDVFIGAIDQGTSSSRFIIYDKSAQPIGSHQVEFTQFYPQAGWVEHNPMEILESVKV
CITKAVDKATANGFNVDKGLKAIGLTNQRETTLVWSKSTGAPLHNALVWMDVRTTSVCRR
LEKELSGGRTHFVESCGLPISTYFSAMKLLWLMENVDAVKEAIKKKDALFGTIDTWLIWN
LTGGVKGGLHVTDASNASRTMLMNLKTLNWDESTLKALQIPAEILPKIISNSEIIGNVSS
GWPVAGIPIAGCLGDQHAAMLGQACRKGEAKSTYGTGAFILLNTGEGVVKSNHGLLSTIA
YKLGPNAPTNYALEGSVAIAGAAVQWLRDGLGLITTAKDIEALALEVESNGGVYFVPAFN
GLFAPWWRDDARGVCIGITRYTSKAHIARAVLESICFQVKDVIDSMHKDSGADQSKKDEF
LLRVDGGATVNNLLMQTQADLLATSVIRPADIETTALGAAYAAGLAVGIWKEDFVFDSKD
LLKNASVFRPLMVEEIRKKKVDSWGKAVSRSFDLADLSL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaagatgttttcattggtgcaattgaccaaggaacaagcagtagcaggttc
ataatatatgataaatcagctcaaccaattggatctcatcaggttgaattcactcagttc
tatccacaagcaggatgggtggagcataatccaatggagatattggagagcgtgaaggtt
tgtattactaaggcagtggataaggcaacagctaacgggttcaacgtggacaaaggattg
aaggctattggtctcaccaatcaaagagagaccactcttgtttggagcaaatccaccggc
gctcctcttcacaatgcgcttgtttggatggatgttcgtactacctctgtttgcaggaga
ctggaaaaagagttatctggtggtagaacacactttgtagagagctgtggtttgcctatt
agcacatatttcagtgctatgaaacttctgtggttgatggaaaatgtggatgctgtcaag
gaagctattaagaaaaaagatgcattgtttggaacaatagacacttggttgatttggaac
ttaaccggtggagtgaaaggaggattgcacgtcactgatgcttcaaatgcatcccgaaca
atgttgatgaacctaaaaaccctcaactgggatgaatctaccttgaaagcacttcaaatc
ccagctgaaattttgcctaaaattatcagtaattcagaaattataggcaatgtttcttct
ggatggccagttgctggtatccctatcgctggatgtttaggtgatcaacatgcagcaatg
cttggacaagcgtgccgtaaaggggaggctaaaagtacttatggtactggtgctttcatt
ctattgaataccggtgaaggagtagttaaatcaaaccatggtcttctgtcaactatagct
tataagcttggtccgaatgctccaaccaattatgcactcgaaggttctgttgctattgct
ggagctgcggtgcagtggcttagagatggtcttggtctcattacaactgctaaagatata
gaggctctggcattagaggtagaatccaatggtggtgtttactttgttcctgccttcaat
ggattgtttgctccgtggtggcgtgatgatgctcgtggggtttgtatcggaataacaagg
tatactagcaaggctcacattgctagagccgtgcttgagagcatatgttttcaagtaaaa
gatgttattgattcaatgcacaaagattctggagcagatcaatccaagaaagatgagttt
ttgcttagggttgatggtggtgcaactgttaacaacctgttaatgcagactcaggcggat
ttgttggcaacttcagtaattagaccagctgacattgaaacaacagcacttggagcagcc
tatgcagctggattagctgttgggatttggaaagaagatttcgttttcgattcgaaggac
ttgctgaagaatgctagtgttttccgtcctctaatggttgaagaaattaggaaaaagaaa
gtagattcttggggcaaagctgttagtagatcttttgacttagcagatctttctctttga

DBGET integrated database retrieval system