KEGG   Medicago truncatula (barrel medic): MTR_4g010150Help
Entry
MTR_4g010150      CDS       T01716                                 

Definition
(RefSeq) fatty-acid desaturase
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     MTR_4g010150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 394 aa AA seqDB search
MALITSQPKNPILHNHFTTLHCSIPQFSRSILNLGPFSNNAKAIKLCNFNSKSRNFPLKN
NPFNFNPKIIAKSNAAIGEATVEPEEEVPLKHRKIFLSDVEVKREKEVFFGRKWNSLDIG
TFVIVLSMHLLCLFAPFNFNWPAFWVSVALYVVTGLFGITTSFHRNLSHRSFKLPKWLEY
FFAYCGVLALQGNPIDWVSTHRYHHQFCDSEKDPHSPIEGFWFSHMSWLFDTNSIAERCG
EPTNVGDLEKQSFYRFLRSTYMVHPFALGALLYAIGGFPFLVWGMGVRVVWVYHITWLVN
SACHVWGKQPWNTRDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLEWWELDMTWYLVK
FLQAIGLATDVKVPSESQKQRMALNNNNNDVVAT
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctttgataacttctcagcctaaaaatcctatactccataatcacttcacaaccctt
cattgttcaataccacaattcagtaggtccattttgaatcttgggccattctcaaataat
gcaaaagccattaaattgtgtaacttcaactccaagtcaagaaattttcccttgaaaaac
aacccctttaattttaatccaaaaattatagctaaatccaatgctgcaattggagaagct
actgtggagccagaagaagaagtgccattgaaacatagaaagatttttctatctgatgtt
gaagtgaagagagaaaaagaagtgttttttggaaggaaatggaattcattagatattgga
acttttgttattgttttgtcaatgcatttgctttgtttatttgctccattcaatttcaat
tggccagctttttgggtttctgtggcactttatgttgttactggattgtttggaataaca
acttctttccatagaaatctttctcatagaagttttaagcttcctaaatggcttgaatat
ttctttgcttattgtggagttcttgctcttcagggaaatccaattgattgggtgagtact
cataggtatcaccaccagttctgtgattctgagaaagaccctcatagtccaattgaagga
ttttggtttagccatatgagttggttatttgataccaattctattgcagaaaggtgtgga
gaaccaaccaatgttggtgatttagagaaacaatctttttatagatttcttagaagcact
tacatggtgcatccatttgctttgggagctcttctatatgccattggtggatttcctttc
ctggtttggggaatgggtgtgagggttgtttgggtttaccacattacttggttggttaac
tcagcttgccatgtttgggggaagcagccttggaacacaagggacttatcaagaaataat
tggtgggtggctttgcttgcatttggtgaaggttggcacaataatcaccatgcatttgaa
tattcagctagacatggtttagagtggtgggaactagacatgacttggtacttggtcaaa
tttcttcaagctattggtttggcaactgacgttaaagtaccaagtgagagtcagaagcag
agaatggcattgaataataataacaatgatgtagtagccacatga

DBGET integrated database retrieval system