KEGG   Medicago truncatula (barrel medic): MTR_4g010150Help
Entry
MTR_4g010150      CDS       T01716                                 

Definition
Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MTR_4g010150
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MTR_4g010150
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MTR_4g010150
Lipid biosynthesis proteins [BR:mtr01004]
 Desaturase
  First
   MTR_4g010150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 572 aa AA seqDB search
MALITSQPKNPILHNHFTTLHCSIPQFSRSILNLGPFSNNAKAIKLCNFNSKSRNFPLKN
NPFNFNPKIIAKSNAAIGEATVEPEEEVPLKHRKIFLSDVEVKREKEVFFGRKWNSLDIG
TFVIVLSMHLLCLFAPFNFNWPAFWVSVALYVVTGLFGITTSFHRNLSHRSFKLPKWLEY
FFAYCGVLALQGNPIDWVSTHRYHHQFCDSEKDPHSPIEGFWFSHMSWLFDTNSIAERCG
EPTNVGDLEKQSFYRFLRSTYMVHPFALGALLYAIGGFPFLVWGMGVRVVWVYHITWLVN
SACHVWGKQPWNTRDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLEWWELDMTWYLVK
FLQAIGLATDVKVPSESQKQRMALNNNNNDVVARHGKEGGRVKEEGRDCSVWWRMMQGIR
AGVGLGVDTWFDDNIRRVVGGGSSTFFWTDNWVGGVPLRVKFPCVFYLATDRWFTVAEMA
RRGWEEGGTAWEWRRRLLDNITDKWWWLLDPVNGYSAKETHHFLTTVDTPQEQGMSVDVW
HKHVLLKVSLFSWRLFRNRIPTKDNFVRRQIL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctttgataacttctcagcctaaaaatcctatactccataatcacttcacaaccctt
cattgttcaataccacaattcagtaggtccattttgaatcttgggccattctcaaataat
gcaaaagccattaaattgtgtaacttcaactccaagtcaagaaattttcccttgaaaaac
aacccctttaattttaatccaaaaattatagctaaatccaatgctgcaattggagaagct
actgtggagccagaagaagaagtgccattgaaacatagaaagatttttctatctgatgtt
gaagtgaagagagaaaaagaagtgttttttggaaggaaatggaattcattagatattgga
acttttgttattgttttgtcaatgcatttgctttgtttatttgctccattcaatttcaat
tggccagctttttgggtttctgtggcactttatgttgttactggattgtttggaataaca
acttctttccatagaaatctttctcatagaagttttaagcttcctaaatggcttgaatat
ttctttgcttattgtggagttcttgctcttcagggaaatccaattgattgggtgagtact
cataggtatcaccaccagttctgtgattctgagaaagaccctcatagtccaattgaagga
ttttggtttagccatatgagttggttatttgataccaattctattgcagaaaggtgtgga
gaaccaaccaatgttggtgatttagagaaacaatctttttatagatttcttagaagcact
tacatggtgcatccatttgctttgggagctcttctatatgccattggtggatttcctttc
ctggtttggggaatgggtgtgagggttgtttgggtttaccacattacttggttggttaac
tcagcttgccatgtttgggggaagcagccttggaacacaagggacttatcaagaaataat
tggtgggtggctttgcttgcatttggtgaaggttggcacaataatcaccatgcatttgaa
tattcagctagacatggtttagagtggtgggaactagacatgacttggtacttggtcaaa
tttcttcaagctattggtttggcaactgacgttaaagtaccaagtgagagtcagaagcag
agaatggcattgaataataataacaatgatgtagtagctcgacacgggaaggagggaggc
cgtgtgaaggaagaggggagggactgctctgtgtggtggcggatgatgcagggtatccgt
gccggtgttgggttgggggtggatacttggtttgatgataacatccggagggttgttggt
ggtggcagtagcacatttttttggaccgataattgggtgggaggagtccccttacgggtc
aaattcccctgcgttttttatttggctactgataggtggtttacagtggcggagatggcg
aggagggggtgggaggaagggggtactgcttgggagtggaggaggcgccttttagacaat
attactgacaagtggtggtggctgctcgaccccgttaatggttactctgctaaggagact
caccactttctcacaacggtcgatacccctcaagaacaaggcatgtccgttgatgtttgg
cataagcacgttctgctaaaggtttcattgttctcttggagactttttcgcaacaggatt
ccaaccaaagataatttcgttcggcgtcaaattctttaa

DBGET integrated database retrieval system