KEGG   Medicago truncatula (barrel medic): MTR_4g024940Help
Entry
MTR_4g024940      CDS       T01716                                 

Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTR_4g024940
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MTR_4g024940
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MTR_4g024940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 334 aa AA seqDB search
MENSEMSTIARRGIHYMQRLNSANVSSALLENGQNRVIDASLTLIRERAKLKGELVRALG
GAVATSSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSTTEEGKDLQDARVLTDVGD
VPIQEIRDCGVDDHRLMNVIGESVKLVMEEDPLRPLVLGGDHSISFPVIRAVSEKLGGPV
DVLHLDAHPDNYDEFEGNYYSHASSFARVMEGNYVRRLLQDAHKQKKFGVEQYEMRTFSR
DRHFLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQGDVVA
GDVVEFNPQRDTVDGMTAMVAAKLVRELAAKIAK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatagtgaaatgtcgacgatagcacgtagaggcatccattacatgcagagactg
aattcggcaaatgtatcatctgctttgctagagaatggccaaaatcgtgtaattgacgct
tcacttaccctgattagagaaagagcaaagcttaagggagaactcgtgcgtgctttggga
ggtgctgttgcaacttcatcgcttcttggagttcctttgggtcataattcctcattcctt
caagggcctgcatttgcacctcctcgcattagggaggccatttggtgtggtagtacaaac
tcgacaaccgaagaaggtaaggatttacaggacgcacgagtgctaactgatgttggtgat
gtccctattcaagaaattcgagattgtggtgtagatgatcatagattgatgaatgtcatt
ggtgaatctgtcaagttagtgatggaagaggatccgttaaggcccttagttttgggtggc
gatcactcaatatcatttcccgttattagagccgtctctgagaagcttggaggaccggtt
gatgttcttcatcttgatgcacaccccgataactatgatgaatttgaaggaaactattat
tcacatgcttcttcttttgctcgagtcatggagggtaactatgttcggcgactcttgcag
gacgcgcacaagcaaaaaaagtttggcgttgagcaatatgaaatgcgaacattttccaga
gatcgccacttcctagagaacctgaaactaggggaaggtgtgaaaggtgtatatatctca
atagatgtggattgtcttgatcctgcttttgctcctggagtgtctcacatagaaccagga
ggtctttcattccgcgatgttcttaacatcctacacaatcttcaaggcgatgttgtggct
ggagatgtggttgaattcaacccacaacgcgatactgtcgatggaatgactgctatggta
gctgctaagttggtgagagaattggctgcaaagattgcaaaatga

DBGET integrated database retrieval system