KEGG   Medicago truncatula (barrel medic): MTR_4g061320Help
Entry
MTR_4g061320      CDS       T01716                                 

Definition
(RefSeq) MAP kinase
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 374 aa AA seqDB search
MENKNPESEKANSKGTLIHDGKYIQYNVLGNLFEVYSNYIPPLQPVGRGAYGIVCCATNS
DTNEGVAIKKIGDAFDNRIDAKRTLREIKLLCHMDHDNVIKIKDIIKPADKEKFNDVYIV
YELMDTDLHQIIQSNQALTDEHCQYFLYQLLRGLKYIHSANVLHRDLKPSNLLLNANCDL
KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILMEIIRREPL
FPGKDYVQQLALITELLGSPNEEDLGFLRSDNAKKYVKQLPHVDKQPFAERFPDMSPLAL
DLAEKMLVFDPSKRITVEEALNHPYMSSLHEINEEPVCPSPFVFDFEQATLNEDDIKELI
WRESLNFCKEQILE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaaaccctgaatctgagaaagcaaactccaaaggaactctgattcacgat
ggaaaatacattcaatacaacgtcttaggcaaccttttcgaagtctactccaactacatt
cctcctcttcaacccgtcggccgcggcgcatacggcatcgtttgctgtgcaactaactca
gatacgaatgaaggtgttgcgataaagaagattggggatgcgtttgataataggattgat
gctaagagaacactgagggaaattaaacttctctgtcacatggatcatgataatgtgatt
aagattaaggatataattaaacccgccgataaggaaaagtttaatgatgtgtatattgtg
tatgagttgatggatactgatctgcatcagattattcaatcaaatcaggctctcactgat
gagcactgccagtattttctatatcaactcttgcgaggattgaagtacatacactctgca
aatgttttgcaccgagatctaaaaccaagcaatttacttctcaatgcaaactgtgatctg
aaaatatgcgactttgggcttgccagaacaacctctgagacagacttcatgacagagtat
gttgtgactcgttggtatagagcccctgaattgctactgaactgttcagaatatactgct
gctattgatgtatggtcggttggttgcattttgatggagataattagaagggagcctctg
tttcctggtaaagattatgttcagcaattggcgctcataactgagttgttaggttcacca
aatgaagaagatctcggattcctcagaagtgataatgcaaagaaatatgttaagcagctc
ccgcacgtagacaagcagccctttgcagagaggtttcctgatatgtctccactggcactt
gatcttgctgagaaaatgctggtttttgatccctccaaacgcataactgttgaggaagca
ctgaatcacccatatatgtcaagtcttcatgagatcaacgaggagcccgtttgtccatcc
ccgtttgtctttgattttgaacaggcaactctgaatgaagatgatataaaggagctcata
tggagggagtctctgaacttctgcaaggagcagattcttgaatag

DBGET integrated database retrieval system