KEGG   Medicago truncatula (barrel medic): MTR_4g063200Help
Entry
MTR_4g063200      CDS       T01716                                 

Definition
Histone H2B
Orthology
K11252  
histone H2B
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 148 aa AA seqDB search
MAPKGEKKPAEKKPAEEKKSTVAEKAPAEKKPKAGKKLPKEGGSAAGDKKKKRSKKNVET
YKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQT
AVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaagggagagaagaagccagcggagaagaaacccgctgaggagaagaagtcc
accgtcgccgagaaggctccggcggagaagaagccaaaggcaggaaagaagctaccaaag
gaaggtggttctgcagccggagacaagaagaagaagagaagtaagaagaatgtagaaaca
tacaagatctacatcttcaaagttctgaagcaggttcacccagacattggtatctcaagc
aaggccatgggtatcatgaacagtttcatcaatgatatcttcgagaagcttgctcaagaa
tcatccagacttgctcgttacaacaagaagccaacaatcacttcaagggaaattcagact
gcagtcaggcttgttcttcctggtgaattggccaagcatgctgtctccgagggaaccaaa
gctgtgaccaagtttactagttcttag

DBGET integrated database retrieval system