KEGG   Medicago truncatula (barrel medic): MTR_4g066710Help
Entry
MTR_4g066710      CDS       T01716                                 

Definition
SNF1-related protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    MTR_4g066710
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MTR_4g066710
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   MTR_4g066710
Mitochondrial biogenesis [BR:mtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    MTR_4g066710
  Mitophagy factors
   Other mitophagy factors
    MTR_4g066710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 512 aa AA seqDB search
MDGSAGPGGGNVNAFLRNYKMGKTLGIGSFGKVKIAEHVLTGHKVAIKILNRRKIKNMDM
EEKVRREIKILRLFMHHHIIRLYEVVETPTDIYVVMEYVKSGELFDYIVEKGRLQEDEAR
SFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKWSVKIADFGLSNIMRDGHFLKTSCGSP
NYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHL
SPGARDLIPRLLVVDPMKRMTIPEIRQHPWFLLHLPRYLAVPPPDTLQQAKKIDEEILQE
VVNRGFEREPLVESLKNRIQNEGTVTYYLLLDNRYRVSTGYLGAEFQETMDSGLSRIHSG
EVAPPIGGQRFPGHMDYQGVGMRQQFPAERKWALGLQSRAQPREIMTEVLKALQELSVCW
KKIGPYNMKCRWAVIIPGHHGGMDNNSVHSNNFLGNDSIIENDVVPKSTVVKFELQLYKT
QEKYLLDLQRLEGPQFLFLDLCAAFLAQLRVL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatggatcagctggccctggtggtggaaatgtgaacgcgtttctacggaattacaaa
atggggaaaactcttggtattgggtcatttggcaaagtgaaaattgctgagcatgtattg
acgggtcataaagttgccattaagattctcaatcgccgaaaaataaagaacatggacatg
gaagaaaaagttagaagggaaataaaaattttaagattgttcatgcatcaccacattata
cgcctttacgaggttgtagaaaccccaactgatatttatgtggtgatggagtatgtgaaa
tctggagaactttttgattacatagtagaaaagggtaggcttcaagaagatgaagctcgc
agtttcttccagcagattatctctggcgtggagtactgtcacaggaatatggtagttcat
agagacctgaaacccgaaaatttacttttggactcaaaatggagtgtcaagattgctgat
tttggcctgagcaacatcatgcgtgatggtcactttcttaagacaagttgcggaagcccc
aactatgcagctccagaggttatctctgggaaattatatgctggacctgaagtagatgtt
tggagctgtggtgtaattttatatgcacttctctgtggcactcttccttttgatgatgaa
aatatccccaacctcttcaaaaaaataaagggtgggatatatacccttccaagccatcta
tctcctggtgccagagatttgataccaaggctgcttgtggtggatcccatgaaaaggatg
accataccagagatacgccaacacccatggttcctacttcatctgcctcgatatttggcg
gtgccaccaccagatacacttcaacaggccaaaaagattgatgaggagattcttcaggag
gtggttaataggggatttgaaagggaaccattggttgagtcccttaagaataggatacaa
aacgagggtactgtaacttactatttgttgttggacaatcgttatcgtgtttccaccggc
tatcttggagctgagtttcaagagacaatggattctggtttgagccgtatccactccggt
gaagttgctcctccaatcggtggacaacgctttccaggacatatggattatcaaggagta
ggaatgaggcaacagttccctgctgagagaaaatgggcccttgggcttcagtctcgagcc
caacctcgtgaaataatgaccgaagtccttaaagctctgcaagaattgagtgtctgttgg
aaaaaaattggaccctataacatgaagtgcagatgggctgttatcatccctggtcatcat
ggaggaatggataacaattctgtgcatagtaataatttccttggaaatgacagcattatt
gagaatgacgttgttcctaagtcaactgtagtcaagtttgagttgcagctgtacaaaact
caggagaaatatctgcttgatcttcaaaggcttgagggtccccagtttcttttcttggat
ctttgtgccgccttccttgcacagcttcgcgttctctaa

DBGET integrated database retrieval system