KEGG   Medicago truncatula (barrel medic): MTR_4g070670Help
Entry
MTR_4g070670      CDS       T01716                                 

Definition
Bifunctional dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MTR_4g070670
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MTR_4g070670
   00670 One carbon pool by folate
    MTR_4g070670
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MTR_4g070670
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     MTR_4g070670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 528 aa AA seqDB search
MASDSSVIINGNGNHNSEPNPQRTYQVVVIATRDMGIAKDGKLPWTLPIDQKFFEDITTV
TSDPGKKNAVVMGRKSWEAIPPENRPLRGRLNIILTRSGSFEIATADNVLICGSVSSAME
LLASSPYCQSIEKVFLTGGAEIFREALHAPGCEAIHITEIEASIECDTFMPRIDFSVFHP
WYTSFPLVENGIRYSFNTYVRVRSSTEESQGLNTDPVLYDNSNPLKFEIKDFTFLPKIIF
ERHEEYKYLKLVEEIISEGTVKDDRTGTGTLSKFGSKMRFNLRRSFPLLTTKRVFWRGVV
EELLWFISGSTSAKVLQEKGIHIWDGNASREYLDSIGLKEREEADLGPVYGFQWRHFGAR
YTNMHDDYSGQGFDQLLDVINKIKHNPDDRRIILSAWNPSDLKLMALPPCHMFAQFYVAN
GELSCQMYQRSADMGLGVPFNIASYALLTYMIAHVCDLVPGDLIHVIGDAHVYRNHVKPL
QEQLQNLPKPFPILKINPKKKDIDSFVAADFKLIGYDPHQKIEMKMAV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgattcttctgtaatcatcaatggaaatggcaatcacaactcagagccgaat
ccgcagaggacttaccaagtagtagtaattgcaacccgagatatgggtattgctaaggat
ggaaaattaccctggacattgcctattgatcaaaagttttttgaggatatcacaacagtg
acatctgatcctgggaagaagaatgccgttgtcatgggtagaaaatcatgggaggctatc
cctcctgagaacagacctctcaggggccgtcttaatattattctaactcgctcgggtagt
tttgaaattgcaactgcagataatgttcttatatgtggaagtgtatcttctgctatggaa
ctgttggcttcttctccttactgtcagtcaattgagaaagtatttcttacaggaggtgct
gagatttttagagaggctcttcatgcacctggatgcgaagccattcatattaccgaaatt
gaagcgagcattgagtgcgacacttttatgccccgaattgatttctctgtatttcatcca
tggtatacgtctttccctttggtggaaaatggcatccgctattcttttaacacttatgtg
cgtgtaaggtcttcaacagaagaatctcagggtcttaataccgatccagttctgtatgat
aattcaaaccctctaaaatttgagatcaaggattttacttttcttcctaagattattttt
gagagacatgaggagtacaagtatcttaaattagttgaggaaatcatttctgaaggcacg
gttaaggacgataggacggggactggtaccttgtccaaatttggttccaagatgagattt
aatctgcgtagaagctttccacttttaacaaccaagagagtattttggcgaggcgttgtt
gaagagcttctttggtttatcagtggctcaacaagtgccaaggtgctgcaggaaaaaggc
attcatatatgggatggcaatgcatccagggaataccttgacagcattggtttgaaagaa
agggaagaggctgacttaggacctgtttatgggtttcagtggaggcattttggtgcaagg
tatactaacatgcatgatgactactccggccaaggatttgatcagctgttagatgttatt
aacaagataaaacacaatcctgatgatcgacgtatcatcctctcagcatggaatccatcc
gatcttaaattaatggcacttcccccctgccacatgtttgcgcagttctatgtggcaaat
ggagagttatcatgtcaaatgtatcaacgatctgctgacatgggtctgggtgtgcccttt
aatattgcatcttatgcgctcttgacatacatgattgctcatgtttgtgaccttgttcca
ggtgatttaatccatgttattggggatgcacatgtttaccgcaatcatgtgaagcctttg
caggaacagctccaaaacctgccaaaaccttttccgatattgaagataaatccaaagaag
aaagatatagattcttttgtggctgctgatttcaagctcataggctatgatcctcatcag
aagatagaaatgaagatggctgtttag

DBGET integrated database retrieval system