KEGG   Medicago truncatula (barrel medic): MTR_4g071990Help
Entry
MTR_4g071990      CDS       T01716                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MTR_4g071990
    1.3.1.94  polyprenol reductase
     MTR_4g071990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 468 aa AA seqDB search
MLAVLGMSEIPGVVQVDSVPVQPGRGAGVVAFGVGRSPKSALAVVLLPPTIAVLQVTALL
DVAGVPSAAVKICTDVVPGVSPPPPLYPQIHVLTFRRIIREDPHPSHHTSLSDENEIRFL
TSSFTLPSTTPRIISSHITMNLSFLSNDQHQIMKTLLVSLLRLSWIAATLPIIIVSIPIP
NLNFLRQILLGFAKRGKTSSSSQKFTVPQRFFLHFYVVSSIWTTFLLVATWIYAYRMAPL
VADPLSYSTLTGFLTGGLTIRHGSDKLREGYVAWQAVFLLLLMEAQVLRRLFETIHVFNY
SPSARMHIIGYLTGLFYYIGAPLSLCGDCALEVFDFLLNLVTEFIVKGKNQMLGWKHWIG
AAIFSWGWIHQYRCHKILGSLRESRQADEYVIPRGDWFEIVSSPHYLSEIVIYASFVVAT
GGSNLTIWLLFAFVVANLAFAAVETHSWYRRKFEDYPSSRFAIIPFIL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgttcttggtatgtccgagattcccggggttgttcaggttgattctgttcct
gttcaacctggaagaggtgctggtgttgttgcttttggtgtcggaagaagtcccaaatca
gcactcgccgtcgttctgcttccacccaccatcgcagtcctgcaagtcactgccttgctt
gacgttgccggagttccgagtgccgccgtcaagatatgcactgacgtcgtccctggagtt
tctccacctccaccgctttatccccaaatacacgtccttacttttcgtagaataatcaga
gaggatccacatccatcacaccacacgtctctttctgatgagaatgaaatcagattctta
acctcttcattcactctcccaagtaccactcctcgtatcatatcctcacatattactatg
aacttgtcttttttgtcgaatgatcaacatcaaataatgaagacacttcttgtttcattg
ctgaggttgtcttggatcgctgctacattgcctattatcatcgtttccattcccattccc
aacctcaactttcttcgccaaatcttgttggggtttgcaaagagaggaaaaacttcatct
tcttctcaaaaatttactgttcctcagagattcttcctgcatttctatgttgtgtcttca
atatggacaacgtttctgcttgttgcaacttggatatatgcttatagaatggcgccacta
gttgcagacccattatcttattctactttaactggttttttgactggaggtttaactatt
agacatggctctgataaactccgggagggatatgttgcttggcaagctgtttttctgctt
ttgcttatggaagctcaagttctaagacggctttttgaaactatacatgtgtttaattac
agcccgtctgctcgcatgcatatcattggttatctcactggattgttttactacatagga
gcaccattatcactgtgtggtgattgtgcattggaggtttttgacttcttattaaatcta
gtgactgagttcattgtcaaaggcaagaatcagatgctcgggtggaaacattggattggt
gcggctattttctcttggggatggattcatcaatatcggtgccataagattcttggttct
ctgcgcgagtcaagacaagcagatgaatatgtaattcctcgcggtgattggtttgaaatc
gtttcctctccacactatctctctgaaattgttatctacgccagttttgtggttgctact
ggtggatcaaatctgacaatatggctactttttgcttttgtggtggccaatctggcattt
gcagccgtggaaacacatagctggtatcgtcgtaaatttgaagattatccgagcagtcgt
tttgctattattccatttattctctga

DBGET integrated database retrieval system