KEGG   Medicago truncatula (barrel medic): MTR_4g100360Help
Entry
MTR_4g100360      CDS       T01716                                 

Definition
Ubiquitin carboxyl-terminal hydrolase isozyme L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_4g100360
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MTR_4g100360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 235 aa AA seqDB search
MATPSSKSSKRWLPLEANPDVMNQFLSGLGLQENQAECHDVYGLDDELLEMVPKPVLAVL
FLYPLTTKSEEERLQQNNEKREYNNKVYFMKQTVGNACGTIGLLHALGNLTSEIKFVEES
FFDKFFKSTANLDPMQRALFLENDTEMEVAHSVAATAGDTEATDDVNTHFICYACVDGEL
YELDGRKSAPISHGPSSPSTLLKDAAKAIQSMIQKDPDSLNFNVIAISKKSSDGY
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctactccttcttccaaatcttccaaaagatggcttcctcttgaagctaaccctgat
gtcatgaaccagttcctttccggtcttggtcttcaagagaatcaagcagagtgccatgat
gtgtatggattagatgatgagcttttggaaatggttccaaagccagttcttgccgtgctt
tttctatatccccttaccaccaagtctgaagaagagcggttgcaacagaataatgaaaaa
agggaatataacaacaaagtatattttatgaagcaaactgtgggtaatgcttgtggtaca
atagggcttcttcatgctcttggtaacttaacttctgaaatcaagtttgttgaggagtca
ttctttgataagttcttcaaatctactgcaaacttggacccaatgcagcgagctttattt
ctcgagaatgacacagagatggaggttgctcattctgtagcagccactgctggtgataca
gaggcaacagatgatgtcaatactcatttcatctgctatgcttgtgtggatggtgaactt
tatgagcttgatggaagaaagtcggcaccaatatcacatggtccttcctcaccaagtact
ttgttgaaggatgctgctaaagccatccagagcatgattcagaaggatccggattctctg
aacttcaatgtcattgcaatatcaaagaaatccagtgatggatattaa

DBGET integrated database retrieval system