KEGG   Medicago truncatula (barrel medic): MTR_4g106870Help
Entry
MTR_4g106870      CDS       T01716                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MTR_4g106870
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MTR_4g106870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 468 aa AA seqDB search
MALNLYSPAELKSGFFTDPLKSNRFTPKFPGGVALKRKENGTASGTRVYCSVQSTSGPPP
AWPGRAIPELGNKTWEGPKPISIVGCTGSIGTQTLDIVAENPDKFRVVALAAGSNITLLV
DQVKRFKPQLVAVRNESLLAELQEALKDVEEKPEIIPGEQGVIEVARHPDAVTVVTGIVG
CAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLARKHNVKYFLLIPNILLFFRVCIQG
LTEGALRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEV
IEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRVYC
SEVTWPRLDLCKLGSLTFKAPDNIKYPSMNLAYAAGRAGGTMTGVLSAANEKAVEMFIDE
KISYLDIFKVVELTCQKHQDELLTSPSLEEIIHYDLWAREYAASLQSS
NT seq 1405 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaatttgtattctccagctgaacttaagtctggttttttcactgaccccctc
aagtctaaccgcttcactcctaaattcccaggtggtgttgctttgaaaagaaaagaaaat
ggaacagcatcaggaacaagagtttactgttcagtgcagtcaacatcaggaccaccacca
gcatggccaggacgagcaatcccagaattaggtaacaagacttgggaaggccctaaaccc
atttccattgtggggtgtactggttcaattggaactcagacactagatattgtcgctgag
aatccagataagtttagagttgtcgcacttgcagctggttcaaacattactcttcttgta
gatcaggttaaaagatttaagccacaactcgttgctgttagaaacgagtctctacttgct
gaacttcaagaagcgttaaaagatgttgaagaaaaacctgagatcatcccgggagaacaa
ggcgtcattgaggttgcacgtcacccggatgcagtcactgttgtcacgggaatagtaggc
tgtgcaggactaaagccaacagttgcggccatagaagctggaaaagacatagctttggcc
aataaagagacactaattgccggaggtccttttgtccttcctcttgcccggaagcataat
gtaaaatacttcctgctgattccgaacattctgctatttttcagagtatgtatccagggg
ttaacagagggtgcacttaggcgagtcattctaactgcatccggaggtgcttttagggat
tggcctgttgagaaactgaaagatgttaaagttgccgatgcattaaaacatcccaactgg
agtatggggaaaaagataaccgtggactctgctacactttttaacaagggtctagaagtg
attgaagcacattacttatttggagctgattatgatgatattgacattgtcattcatcca
caatcaatcatacattcaatgattgaaacacaggattcatctgttcttgcacaattgggg
tggcctgatatgcgtttgccaatcctttatacattatcatggcctgacagagtttattgt
tctgaagtcacttggcctcggcttgatctttgcaagcttggttcccttacttttaaagct
cctgacaacattaagtatccatccatgaatcttgcctatgctgctggccgcgctggaggc
accatgacaggtgttcttagtgcagcaaatgagaaagctgtagagatgtttattgatgaa
aagattagctatttggatattttcaaggttgtggagctaacatgtcagaagcatcaagat
gaattgttgacctcaccttcccttgaggaaattattcactatgacttgtgggcacgagaa
tatgctgctagtttgcaaagctctt

DBGET integrated database retrieval system