KEGG   Medicago truncatula (barrel medic): MTR_4g115880Help
Entry
MTR_4g115880      CDS       T01716                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_4g115880
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MTR_4g115880
Transcription machinery [BR:mtr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MTR_4g115880
Ubiquitin system [BR:mtr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    MTR_4g115880
Chromosome [BR:mtr03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     MTR_4g115880
    SLIK complex
     MTR_4g115880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 594 aa AA seqDB search
MSSKINGQISPQPCPHLAEFRRTSTKPFLSLHNCLRIKPPGGRASLRRDPHEIPHCNACG
LSAPSRLYACISCAAVSCHSSTVGVISHAAAHAASMSPGHQIAIDVDRAELFCCVCRDQV
YDRDFDAAVVIAQTVASTIGDVEKSTVIPMPSTTHPENLRKRRRVDYRPSTPDLRERALI
GSCSSPINVPDFPRGLRGLNNLGNTCFMNSVLQALFHTPPLRNYFLSDKHNRYFCQKMSN
ADDAANGDDSAITTAKRNGDNNGIKNGRLCLACDMDAMFSAVFSGDRLPYSPAKFLYSWW
QHAAKSNLASYEQQDAHEFFISMLDGIHEKVDKDRHKPHNEGSDCCIAHRVFSGILRSDV
MCMACGFTSTTYDPCVDISLDLEPNQGGSTKMAAAASNPSCTGEADSSQNFGISTLMGCL
DRFTRAEKLGSNQKFFCQQCKVKQETLKQMSIRKLPLVSCFHIKRFEHSSRKKMSRKVDR
YLQFPFSLDMSPYLSSSILRSRFGNRIFPFDGDEPDASNDLCSEFELFAVVTHSGKLDAG
HYVTYLRLSNQWYKCDDSWVTQVDENIVRAAQGYMMFYVQKMLYYKATDKSVAS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaaaatcaacggtcagatttcaccacaaccatgtccccacttggccgagttc
cgccgcacttccaccaaaccattcctctctctccataactgcctccgtatcaaacctccc
ggcggccgcgcctccctccgccgtgatcctcacgaaattccgcactgcaacgcctgtggt
ctctccgctccttcccgtctctatgcctgcatctcatgcgccgctgtatcatgtcactct
tccaccgtcggtgtcatttcccacgccgccgcacatgccgcatcaatgtctcctggtcat
cagatcgcaatcgacgtcgatcgcgccgagcttttctgctgcgtttgccgtgatcaggtt
tacgatcgtgatttcgacgccgcagttgtgatcgcacagaccgttgcgtccacaatcggc
gacgttgaaaaatcaacggtgatccctatgccatctactacgcatccggagaatctcaga
aagcgccgcagagtagattatcgtccttcgactccggatctacgtgaacgtgctctgatc
ggaagctgttcttctccgatcaatgttcctgatttcccccggggattgcggggattgaac
aatctcggaaacacttgtttcatgaattcggtgttgcaggctttgtttcacacgccaccg
ttgaggaattacttcctgagtgataagcataatcggtacttttgccagaaaatgagcaat
gccgatgatgccgcaaatggtgatgattctgccataacaacagcgaaaagaaacggagat
aacaatggaataaaaaatggaagattatgcttagcttgtgatatggatgctatgttctct
gctgttttttctggagatcgtcttccctatagcccagcaaagttcttgtacagttggtgg
cagcatgcagccaagtccaaccttgcaagctatgaacaacaggatgcacatgaatttttc
atttcaatgcttgatgggatccatgaaaaggtggacaaggatcgacataagccacacaat
gaaggcagcgattgttgtattgctcatagggttttctctggtattttgcggtcagatgtt
atgtgtatggcctgtggtttcacatcaacaacttatgacccatgcgtagacatctcactt
gacttggaaccaaatcaagggggttctactaagatggctgctgcagcttccaatccttct
tgcactggtgaggccgattccagccaaaactttgggatatctaccttgatggggtgcttg
gatagatttacaagagcagagaaattggggtcaaaccaaaagtttttctgtcagcagtgt
aaggtgaagcaggaaactctcaagcagatgtccatacggaagcttccccttgtttcttgc
ttccatataaaaagattcgagcactcttcaagaaaaaaaatgtcaaggaaggtggaccgt
tatttgcagttcccattttcactggacatgtcaccttatctctcatcctcaatcttaagg
agtcggtttggtaacagaatatttccttttgatggggatgagcctgatgcttcaaatgat
ctatgttctgagtttgaattgtttgccgtcgtcactcattctggtaagttagatgctggt
cattatgtgacttatctgcgattaagcaatcaatggtacaagtgtgatgattcttgggtt
actcaagttgatgaaaacattgtgagggctgctcagggttacatgatgttctatgtacag
aagatgctttactataaagcaactgataaatcggtcgcctcatga

DBGET integrated database retrieval system