KEGG   Medicago truncatula (barrel medic): MTR_4g120130Help
Entry
MTR_4g120130      CDS       T01716                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation MFP-A protein
  KO
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MTR_4g120130
  Lipid metabolism
   00071 Fatty acid degradation
    MTR_4g120130
   00592 alpha-Linolenic acid metabolism
    MTR_4g120130
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MTR_4g120130
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     MTR_4g120130
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MTR_4g120130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 723 aa AA seqDB search
MSSRKGHTVMNVGADGVAIITIINPPVNSLSFDVLQSLKESFDQAIQRDDVKAIVVTGAK
GKFSGGFDISAFGGLQEAKERPKPGWISIEIITDTIEAAKKPSVAAIDGLALGGGLEVAM
ACNARLSTATAQLGLPELQLGIIPGFGGTQRLPRLVGLTKALEMMLTSKPVKGKDAFSSG
LVDGLVSPDQLVNTARQWALDILDRRRPWIASLYKTEKIEPLGEAREILKFARAQARKQA
PNLKHPLVCIDVIEAGIVSGPRAGLWKEAEAFDALVQSDTCKSLIHIFFAQRGTSKVPGV
TDRGLVPRPVKKVAILGGGLMGSGIATALILSNYSVILKEVNEKFLDAGINRIKANLQSR
VKKGNLTQERFEKAFSLVKGSLDYDSFRDVDMVIEAVIENVSLKQQIFADLEKYCPPHCI
LGSNTSTIDLDLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTKRTSPQVIVDLLDISKK
IKKTPVVVGNCTGFAVNRVFFPYTQATLLLVERGADVYQIDKAVTKFGMPMGPLRLCDLV
GFGVAVATGSQFVQNFPERTYKSMLIPLLQEDKRAGETTRKGFYLYDDRRKASPDPELKK
FIEKARSISGVSVDPMLVKLQEKDIIEMIFFPVVNEACRVLDEGIVVKAADLDIAAIMGM
GFPPYRGGIIFWADSLGSKYIYSRLEKWSELYGPFFKPCAYLAARAAKGIPLGASMEQVK
SRL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcagaaaagggcacacggttatgaatgttggagctgatggagttgccatcatc
accatcatcaatcctcccgtcaattctctctcctttgatgtattgcaaagtttaaaggag
agttttgatcaggctatacaaagagatgatgtcaaggcaattgttgttacaggtgccaag
ggaaaattttctggaggttttgatatttctgcatttggtggtcttcaagaggcaaaagag
cgtccaaaacctgggtggatatcgattgaaatcatcactgatacaatagaagcggcaaag
aaaccatcagttgctgccattgatggccttgccttgggtgggggcttagaagttgcaatg
gcatgcaacgcacgattatcaactgcaactgctcaactaggtttgcctgaacttcagctt
gggataattcctggatttggaggaacacagcgacttcctcgtcttgttggtctgacaaag
gcacttgaaatgatgttgacttccaagccagtgaaagggaaggatgcttttagttcgggg
cttgtagatggtttggtgtcacctgatcagttggtgaacactgcacgccagtgggccttg
gatattttggaccgtcgacgaccatggattgccagtctttacaagactgaaaaaatagaa
ccacttggcgaagctagagagattttgaaattcgcacgtgcccaagctcgaaaacaagct
cccaatctcaagcatcctctggtttgcattgatgttattgaagcaggaatagtgtctggt
ccccgtgctggtctctggaaggaagctgaagcatttgatgcactggtacaatcagatact
tgcaaaagcttaattcacatattttttgctcaaagaggaacatctaaggtacctggggtt
actgatcgtggtctggttccaagacccgtgaagaaggttgccatccttggtggaggacta
atgggctctggaatagcaacagctttaatactgagtaattattctgtcatattgaaagaa
gtaaatgaaaaattcttggatgctggtatcaataggattaaagcaaacctacagagccgt
gttaagaaaggtaatttaacccaggaaagatttgaaaaggcattctctcttgtcaaaggt
tccctcgactatgatagcttcagagatgtggacatggtgatagaggctgttattgagaat
gtttccttgaagcaacaaatctttgctgatcttgaaaagtactgtccacctcattgtata
cttggtagtaacacttccacaattgacttggacctgatcggagaaaagaccaagtctcaa
gatcgaattattggagcccatttcttcagtcctgcacatgttatgccacttctggagatt
gtacgtaccaagcggacatctcctcaagtaatagttgacttgttagatatttcaaagaag
ataaagaaaactccggtggtggttggaaactgtacaggatttgctgttaatagggtgttc
ttcccatatacacaagcaactctcttgcttgttgaacgtggcgcagatgtttaccaaatt
gataaagcagtaaccaaatttggaatgcccatggggcctttaagattgtgtgaccttgtt
ggtttcggtgtggcggttgcaaccggctcccaatttgttcagaactttcctgagcgaact
tataaatcaatgcttatccctcttttgcaagaggataagagggctggagaaacaactcga
aaaggcttttatttgtacgatgatagacgcaaggccagtcctgatcctgaattaaagaaa
tttattgagaaagctaggagcatttccggtgtctccgttgatcctatgcttgtcaagtta
caagagaaggacatcattgagatgatcttctttcctgtggtgaatgaggcttgtcgtgtc
ctcgatgaaggtattgtagtcaaagcagcagatcttgatattgctgctatcatgggaatg
ggctttccaccttacaggggaggtatcatattctgggccgactctcttggatctaaatac
atatattcaagattggagaaatggtcagagttgtatggaccgttcttcaagccttgtgcc
tacctggctgcaagagctgccaaaggaattcctctgggagcctcaatggagcaagttaag
tcacggctgtag

DBGET integrated database retrieval system