KEGG   Medicago truncatula (barrel medic): MTR_4g127950Help
Entry
MTR_4g127950      CDS       T01716                                 

Definition
Replication factor A protein
Orthology
K10739  
replication factor A2
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MTR_4g127950
   03420 Nucleotide excision repair
    MTR_4g127950
   03430 Mismatch repair
    MTR_4g127950
   03440 Homologous recombination
    MTR_4g127950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 278 aa AA seqDB search
MHANQFDGNAAFAGGGFMPSQTNQGGESSLTPSKNRESQTLLPLTIKQINHALQSSDDRT
GLTIDGVGVNTVTLVGRVCNKSGQITEFKFVLDDGTGTIECTKWLHEPADAMAVESILNG
MYVRLYGQLKGFQGKTLSIFSLRPVTDFNEIASHFIECIYVHLYNSRLQYTQASIPSQQH
APNSIQITPTKGYQAQAIPPNQFSGQHNNGQKSVQELVLEYLALPTIRELEGGVFCGTIA
KQLGVSLDNDVIPALDLLSGEGVIYEGLPKHYKICSDG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcgaatcagttcgacggcaacgccgccttcgccggcggcggtttcatgccttct
cagaccaatcaaggcggtgaatcctctctcactccctccaagaatcgcgaaagtcaaact
ttgcttccgctgacgatcaagcagatcaaccatgctcttcaatcaagtgatgatagaacc
ggtcttactattgacggtgttggcgttaacaccgttactcttgttggtagggtttgcaac
aaatctggacagattactgaatttaagtttgtacttgacgatggcaccggaacgattgag
tgtactaaatggcttcacgaacctgctgatgcaatggcagtggagagtatcttgaatgga
atgtatgtgcggttatatggacagttgaaaggttttcagggtaaaaccttaagtattttc
tctctcaggcccgttactgacttcaatgagatcgcctcccatttcattgagtgcatttat
gttcatctatacaattcgaggttacagtatacccaggctagcatccccagtcagcaacat
gctcccaattccatacaaatcactcccacaaaaggttatcaagctcaagccattccacca
aatcaattctccggtcagcataataatggtcagaagagtgttcaagagttggtgttagaa
tatttggctcttcccacaatcagggaattggaggggggagtcttttgtggaactattgca
aagcaacttggagtttctttggataatgacgtcatacctgctcttgatcttcttagtgga
gaaggtgtcatttatgaaggtctaccaaagcactataagatatgttccgacggttga

DBGET integrated database retrieval system