KEGG   Medicago truncatula (barrel medic): MTR_4g128840Help
Entry
MTR_4g128840      CDS       T01716                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mtr00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtr00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 478 aa AA seqDB search
MKSGKLLLLLLSFNVFYYAAVNCAPQTCPATKDAKCGDSDDWKAEFFPGISKIKYEGPSS
KNPLSFKWYNPEEEILGKKMKDWFRFSVAFWHTFRGTGVDPFGAPTKYWPWEDGTNSLSM
AKRRMRANFEFINKLGVDFWCFHDRDIAPDGKTIEESNENLDEVVALAHELQRQSKKRVL
WGTAQLFVHPRYMHGAATSSELAVYAYAAAQVKKALEVTHYLGGENYVFWGGREGYQSLL
NTDMERELNHLARFFEAAVAHKKKIGFNGTFLIEPKPQEPTKHQYDWDAATAANFLRKYG
LIGEFKLNIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEA
TMIMLSVIRNGGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGS
LAELVRKRYQSFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgggaaattgttactgcttcttctttctttcaatgtcttctattatgcagca
gtgaattgtgcacctcagacatgccctgctaccaaagatgctaaatgtggtgattcagat
gactggaaagcggaattttttcctggcatttccaaaattaaatatgaggggccttccagt
aagaatccactttcatttaaatggtataatccagaggaggaaattcttgggaagaagatg
aaggattggttcagatttagtgttgcattttggcatacattccgtggaacaggtgttgac
ccatttggtgcacctaccaaatattggccatgggaagatggtaccaattcattaagcatg
gctaaaagaagaatgagagcaaattttgagttcataaacaaacttggagtcgatttctgg
tgcttccacgacagggatatagctcctgatgggaagactattgaggaatcaaatgaaaac
ctggatgaagttgtggcccttgctcatgagcttcagcgtcagagcaaaaagagagttttg
tggggaacagctcagttgttcgtgcatcctcgttatatgcatggtgctgctactagctcc
gagttagcagtgtatgcatatgctgcggctcaagtgaagaaagccttggaggtgacacat
tatttggggggagaaaattatgtgttttggggcggtcgagagggttaccaatctcttttg
aacacagatatggaacgagagcttaatcatttggctagattttttgaagctgctgttgca
cacaaaaagaagatcggattcaatgggacatttttaattgaaccaaagccacaagaacct
actaaacatcagtatgattgggatgctgcaactgcagctaatttcttgcgaaaatatgga
cttataggggaattcaaacttaacattgagtgcaaccatgccactctatctggtcacagt
tgccatcatgagcttgaaactgcaaggatcaatggattattgggtaatatcgatgcaaat
actggtgatcctcaagttggttgggacacggatcagtttctcgtagatatccaagaggca
acaatgattatgctcagcgttatcagaaatggtggaattgcaccaggtggattcaacttt
gatgccaaattgcggagagagagcacagatgttgaagacttgttcatagctcatattgtt
ggcatggatacaatggccagaggtctcaggaatgctgccaagctagttgaggatggttct
ctggccgagcttgttcgcaagcgatatcagagttttgacacagaaattggggctcaaata
gaggccggaaaagccgactttgattttcttgagaagaaggtcaaggaatggggagaacca
aaggttgcttctgcgaaacaggagctagccgagatgatattccagaatgctatgtag

DBGET integrated database retrieval system