KEGG   Medicago truncatula (barrel medic): MTR_5g005380Help
Entry
MTR_5g005380      CDS       T01716                                 

Definition
Serine/threonine protein kinase mTOR
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   MTR_5g005380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 2645 aa AA seqDB search
MATTSQSHSHSHSHRYIGPPSVLPGDALNRILADLCTRGNPKEGASLAFKKHLEEEARDL
SGEAFSRFMDQLYDKISSHLESSDVAENLGALRAIDELIDVALGENGSKVSRFSSYMRTV
FEAKRDPEILVHASRVLGHLARAGGAMTADEVERQVKIALDWLEGPRIEYRRFAAVLILK
EMAENASTVFNVHVPEFVDAIWVPLRDPALPVRERAVEALRACLNVIEKRETRWRVQWYY
RMFEATQDGLGKNAPVHSIHGSLLAVGELLSEKSYKIGEVRRDMIELEMTTLERVGVAPM
VEKMAEICKARSDYDRTFRKDLEINELDPNVVYDRTLWRNLIHVADPTWWDMFMAIGILL
SAKFYEAKFGLWNTGEFMMSRYREVAEIVLRYLEHRDRLVRLSITSLLPRIAHFLRDRFV
TNYLTICMNHILSVLKVPQDRDSGFIALGEMALALDGELSHYLPTISTHLREAIAPRRSK
PSLEALACVGNIAKAMGPTTEPHIRGLLDVMFSAGLSTVLVETLEQISMSIPSLMPTIQD
RLLDSISMVLSKSPYLGRPAQSIGRGTNIIVVPQVSELSGSALIQLALQTLARFNFKGHD
LLEFARESVVVYLDDEDRSTRKDAALCCCKLIATSFSGIASAHFGSNRLSRSGGKRHRLI
EELVEKLLISAVADADVTVRHSIFTSVHGDRGFDEYLAQADNLSAVFAALNDEDFDVREY
TISVAGRLSEKNPAYVLPALRRYLIQLLTYLGQSSADSKCKEESAKLIGCLIRNCERLIL
PYIAPIHKALVARLVDVNANIGIISGVLVTVGDLARVGGFAMRQYIPELMPLIVEALLDG
AAVSKREIAVATLGQVVQSTGYVITPYNEYPQLLGLLLKLLNGELVWSTRREVLKVLGIM
GALDPHLHKRNQKALPGPHGEVTGPACDSSQQIQSIDEFPKDLWPSFASSDDHYSTVAIN
SLMRILRDPSLASYHLKVVGSLMFIFKSMGLGCVPYLPKVLPDLFHTVRTCEDSLKDFIT
WKLGTLVSIVRQHIRKYLQDLLSLVSEFWSAFSLPAPARPALGYPVLHLVEQLCLALNDE
FRTYLPVILPRCVQIISDAERCNDYTYVLDILHTLEVFGGTLDEHMHLLLPALIRLFKVD
TSVDIRRAAIKTLTRLIPRVQVTGHISSLVHQLKLVLDGKNDDLRKDAVDALCCLAHALG
EDFKIFIPSIHKLLRKYHLRHKEFEEIEGRLQRREPLILGTTATQRLNQRLPVEVISDPL
HDVEKDPYEAGYDAHKLKGHQVNDSRLRSAGEASQRSTREDWAEWMRHFSIQLLKESPSP
ALRTCARLAQLQPFIGRELFAAGFVSCWAQLNEATQRHMVRNLEMAFSSPHIPPEILATL
LNLAEFMEHDEKPLPIDIRLLGALAEKCRAFAKALHYKEMEFEGARFTKMDANPVSVVEA
LIHINNQLHQHEAAVGVLTYAQQNLEFQLKESWYEKLQRWDDALKAYTAKASQVTSAQLV
LETTLGRMRCLAALARWEELSDLCKEYWTPADAVTRLEIAPMAANAAWNMGEWDQMAEYV
SRLDDGDETKLRSAGNNASSSDGSSNGTFFRAVLSVRRGKYDEAREYVERARKCLATELA
ALVLESYERAYSNMVRVQQLSELEEVIDYCTLPIGDRVAEERRALIRNMWTQRIEGAKSN
VEVNRVSPWNCICMLKHLHSFPTELHMHVWQALLAVRTLVLPPAEDIETWLNFASLCRKS
GRISQARSTLVKLLQYDPEITPENVQYHGPPQVMLAYLKFQWSLGEDSKRREAFIRLQNL
AMEFSSAPNIQPVTQTVFTSGLNPSVPLLARVYLKLGSWQWSLSPGLVDESIKDILNAFT
KATQYANKWAKAWHKWALFNTAVMSHYTLRGFPDIAAQFVVAAVTGYFHSIACAANSKGV
DGSLQDILRLLTLWFNHGATAEVQMALTKGFSLVNINTWLVVLPQIIARIHSNNHAVREL
IQSLLVRIGQNHPQALMYPLLVACKSISNLRKAAAQEVVDKVRKHSGVLVDQAQLVSKEL
IRVAILWHELWHEGLEEASRLYFGEHNIEGMLKVLEPLHEMLEEGAMKNNATIKERIFIE
AYRQELLEAYECSMNYRRTGKDAELTQAWDIYYHVFRKIDKQLQSLATLDLETVSPELLE
CRNLELAVPGTYRADVPVVTIASFARQLEVIPSKQRPRKLTIHGSDGDDYAFLLKGHEDL
RQDERVMQLFGLVNTLLENSPKTAEKDLSIERYAVIPLSPNSGLIEWVPNCDTLHQLIRE
FRDARKVILNHEHKCMLSFAPDYDHLPLINKVEVFEHGLSSSEGNDLAKVLWLKSRTSEV
WLERRTNYTRSLAVMSMCFADLGFGEEQTIDEDKICSSMSLHTPEFDDVVYELTSFATGN
LTIVGYLLGLGDRHPSNLMLHRFSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKA
MEVSGIEGNFRSTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQMSMLNSN
HVPPVVTSDESGANRELPHPQRGVREREILQAVNQLGDANEVLNERAVVVMARMSNKLTG
RDFSTCSSVLNTSLQNAVDHNSLGAGDAREIDQALSVKLQVQKLISHATSHENLCQNYVG
WCPFW
NT seq 7938 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgtctcagtcgcactctcactcccactcccaccgttatatcggtcctccc
tctgtcctacccggtgatgcactcaatcgtattctcgccgatctctgcactcgcggaaac
cctaaggaaggagcttctttagcttttaagaagcatctagaagaagaagcacgtgactta
agtggtgaagctttttcgcgatttatggatcaattgtatgataagatatcgagtcatttg
gagagtagcgatgttgccgagaatctaggagctcttagggcaattgacgagttaattgat
gtggcgcttggtgaaaatggttctaaggtttctagattctcaagttatatgcggactgtt
tttgaggcgaagcgtgatccggagattttggttcatgcgagtagggttcttggtcatctt
gctagagctggtggagctatgactgctgatgaagttgaacgtcaggttaaaattgcattg
gattggcttgaagggcctagaattgagtatcggcggtttgcagctgttttaatcttgaaa
gaaatggcagaaaatgcttcaactgtttttaatgtccatgtgccggaatttgtcgatgct
atctgggttcctttgagagatccagcattgccagttcgtgagcgggctgtggaggcattg
cgtgcttgccttaatgttattgaaaagcgtgagacacgctggcgtgtgcaatggtattat
cgaatgtttgaggctacacaagatggattaggtaaaaatgctccagtgcacagtatacat
ggctcgttgctcgctgttggagagcttttgagtgaaaaaagctacaagataggtgaggta
agacgagacatgatagaattagaaatgacaacattagagagagttggggtagcacctatg
gtagaaaagatggcagaaatttgtaaggctaggtcagattatgacagaacttttaggaaa
gatttagagattaatgagttggatccaaatgtggtttatgatagaacattatggcgtaat
ttgatccatgtagccgaccccacttggtgggatatgttcatggccattgggattctgtta
tcagcaaaattctacgaggccaaatttggtttatggaatactggtgaattcatgatgtca
agataccgagaagttgccgaaattgttcttagatatctagagcaccgggatcggcttgtt
cgcttgagcattacttcgttgctacctcgaattgcacattttctgcgtgatcgttttgta
accaactatttaacaatatgcatgaatcatattctttccgtcttgaaagttcctcaagat
cgtgatagtgggttcattgctctcggagagatggctttggcactggatggggaacttagc
cattatttgccgacaatatctactcatttacgcgaggcaattgctccgcgtaggagtaaa
ccctcacttgaggccttggcttgtgttggaaatattgcaaaagcaatggggcctactact
gaacctcatattcgtggacttctggatgttatgttttctgctggtctttcgactgttctt
gtggaaactcttgagcaaataagcatgagcattccatctctgatgccaaccattcaagac
cggttactcgacagcatatctatggttctctctaaatcaccttatctagggaggcctgca
caaagcatcggtagaggaacaaatataattgtcgttccacaagtttcagagcttagtggt
tctgctcttatacagcttgctttgcagactcttgctcgctttaactttaagggccatgat
ctacttgagtttgccagggaatcagttgttgtctatttggatgatgaggatagatctaca
cgaaaagatgcagctctatgttgttgcaaattaattgctacttctttctctggtattgca
agtgcacattttggttctaacaggttgtctcggtccggagggaagcgccatcgtcttatt
gaggagcttgtggagaagcttctcatttctgctgttgcagatgctgatgttaccgtacgc
cactctatcttcacttctgttcatggagacagagggtttgatgagtatttggcacaggct
gacaatttgagtgcagtatttgccgctttaaatgatgaggattttgatgttcgggagtac
acaatttctgtggctggaaggttgtcagagaaaaatcctgcatatgttcttccagctctt
cgtcgttatctcatacagttgttgacatacttgggccaaagcagtgctgatagcaaatgc
aaggaggaaagtgcaaagttaattggctgtttgataaggaattgtgaacgactaatactt
ccatacattgctccaattcataaggcactcgtggccagacttgttgatgttaatgccaat
attggaattataagtggagtccttgtaactgtgggggatcttgccagggtgggaggtttt
gcaatgaggcaatacattcctgaacttatgcctttaattgttgaagctttattggatgga
gcagctgtctccaaacgtgaaatagcagttgctacccttggtcaagttgtacagagcact
gggtatgttattactccatataacgagtatccacaactacttgggttactcttaaaatta
ctgaatggtgagctagtgtggtctaccaggcgtgaagtattgaaggttcttggcataatg
ggtgctttggatcctcatttgcataaacgaaatcaaaaagcactgccagggcctcatgga
gaagttacaggccctgcttgtgattcaagccaacagattcagtctattgatgaatttccc
aaagacttgtggccttcttttgcttcatcagatgaccattattccacggttgcgattaat
tctctcatgcgtattttaagggatccgtcacttgctagttaccacttaaaggtcgttggg
tctctgatgttcatattcaagtcaatgggactaggctgcgttccatacttgccaaaggtt
ttgcctgatctctttcacactgttcgtacatgtgaagatagtttgaaggatttcattaca
tggaagcttgggactctggtgtcaattgtgcgccagcacattcgaaaatatttgcaagat
ttgctctctttagtatccgaattttggtccgcattctctcttccagccccagctcgtcct
gcccttggctatccggtacttcacctggtagaacaactttgcttggctcttaacgatgaa
tttaggacatatcttccagttattctgccgagatgcgtacagataatcagtgatgcagaa
cggtgcaatgactacacttatgttcttgatattctccacactctagaagtttttggtggg
actttggatgagcatatgcatctacttcttcctgctcttattcgtttgtttaaagtggat
acctcagttgacataagacgtgctgcaattaaaactttgacacgattgatacctcgtgtg
caggtcactggtcacatatcctctcttgttcatcagttgaagttagttttggatgggaaa
aatgatgatctccgaaaggatgctgttgatgcactttgttgtttggctcatgcccttggc
gaggatttcaagatttttataccatcaatacacaaacttcttcggaaatatcacttgcgg
cacaaggaatttgaggaaattgaagggcgtctacagagacgtgagccgctaattcttggg
acgacagctactcaaagactgaaccaacgacttcctgttgaggttattagtgatccacta
catgatgtggagaaagatccttatgaagctggatatgatgctcacaaactcaaaggccat
caggttaatgatagtcgattacgatctgctggtgaggcttctcagcgaagtacaagggaa
gattgggcagaatggatgaggcattttagcattcaacttttaaaggaatctccttctcca
gccttacgaacctgtgctaggcttgcacagttgcagccttttattgggagagaattgttt
gcagctggatttgtcagctgttgggcacagctcaacgaggctactcagagacatatggtt
cggaatctagagatggcattttcatctccacatattcctccggaaattttggcaactcta
ctcaatttggctgagttcatggaacatgatgagaaacctcttcctattgacattcgtctt
cttggtgcacttgcagaaaagtgtcgtgcatttgcaaaagccttgcactataaagaaatg
gaatttgaaggagctcggtttaccaagatggatgctaacccagtttctgtagttgaagct
cttattcatataaacaaccaattgcaccaacacgaggctgcagttggagtattgacctat
gctcaacagaatctagaatttcaactcaaggagtcatggtatgagaaactgcagcgatgg
gatgatgctctcaaggcatatactgcaaaggcgtctcaagtaacaagtgcacaacttgtg
ttggaaaccactttaggtaggatgagatgccttgctgcattagctcgatgggaagagtta
agtgatctatgtaaggaatattggacccctgctgatgcagtaactcgtcttgaaatagca
ccaatggctgctaatgctgcttggaacatgggagaatgggaccaaatggcagaatatgtg
tctcggttagatgatggcgatgaaacaaaacttcgaagcgcgggaaataatgcttctagt
agtgatggaagtagtaatggtaccttcttcagggctgttctatcagttcgcagaggaaag
tatgatgaagcacgtgagtatgttgaaagagctagaaaatgtctggcaacagagcttgct
gctttggttttggagagctatgagcgtgcttacagcaatatggttcgtgttcagcaacta
tctgaactagaagaggtgattgattactgtacacttcctattggagatagagttgctgaa
gagcgacgggctcttattcgcaacatgtggactcagcgtatagaaggagcaaagagcaat
gttgaggtaaacagagtttccccatggaactgcatatgcatgcttaaacatttacacagt
ttccccacggaactgcatatgcatgtttggcaggcacttttggctgttagaacacttgtg
ctgccaccagctgaagacattgaaacatggctcaattttgcttctctttgcagaaaaagt
gggcgcattagccaagcaagatctactttagttaaacttctacagtatgaccctgagata
actcccgaaaatgtccaatatcatggcccacctcaagtaatgctggcgtacttaaagttc
caatggtcacttggagaggattcaaagcgtagagaagcatttattaggctacagaatttg
gctatggaattttcaagtgcacccaacattcagccagttacacaaacggttttcacaagt
ggtttgaatccaagtgttcctctccttgctcgtgtttatctgaaacttggctcctggcag
tggtcactttcccctggactagttgatgagtccataaaagatatactcaatgcattcaca
aaagctactcagtatgcaaataaatgggccaaagcttggcataaatgggcattgttcaat
acagcagtgatgtctcattacactttaagaggtttccctgacattgcagcacagtttgtt
gttgctgctgtcacgggatactttcattctatagcatgtgcagcaaattcgaaaggtgtt
gacgggagtttacaggatattcttcgacttttgacactatggttcaaccatggagctact
gcagaagttcaaatggccctaacgaaaggattttcccttgttaatatcaatacgtggcta
gtagttctgccccaaatcattgccaggatacactctaataaccatgccgtgagagagttg
atacaatcacttttggttcgaattgggcaaaatcatccacaggctctcatgtatcctttg
ctcgtggcctgtaaatcaataagcaacttgcgcaaagctgcagctcaggaagttgtggac
aaagttcggaagcatagtggtgtgcttgtggatcaggcccaacttgtatcaaaagaactt
atcagagttgctattctttggcacgaactatggcatgaaggactggaagaagccagccgt
ctttatttcggcgaacataatatcgaagggatgctaaaggtcttggagccattgcatgaa
atgcttgaagaaggtgcaatgaaaaacaatgctaccataaaggagagaatttttattgag
gcctatcgacaggaattattagaggcttacgaatgctctatgaattataggagaactggg
aaagatgccgagcttactcaggcatgggatatctattatcatgtgttcagaaagatagat
aagcaacttcaaagtcttgctactttagacttggagacggtttctccagaattgctagaa
tgccgaaatttagagcttgctgttcctgggacataccgcgctgatgtcccagtggttact
attgcatcatttgcacgccagcttgaagtcataccatctaagcaacgacccaggaaatta
actattcatgggagtgatggtgatgattatgcctttttattgaaggggcacgaggattta
cgccaggatgaacgagttatgcagctttttggtttggtgaatactctgcttgagaattct
cctaaaacagctgagaaagatctctctattgaacgatacgctgtaatcccgttatctcca
aacagtggtttaattgaatgggtcccgaattgtgacactttacatcaacttatccgggag
ttcagagatgctagaaaggtcatcttgaatcatgaacacaaatgcatgctcagttttgca
cctgattatgatcatttgcctcttataaataaagtggaggtgtttgaacatggtttgagc
agttctgaaggaaatgacctagcaaaagtgctttggttgaaaagtcgaacttctgaggta
tggctcgagaggaggacaaattacaccagaagtttggcagttatgagcatgtgttttgca
gatctgggttttggggaagaacaaacaattgatgaagataagatttgctcctctatgagt
ttacatacacccgagtttgacgatgttgtatatgagcttacttcttttgcaactggaaat
cttactattgttggctatcttcttgggttgggtgatcgccatcctagcaatcttatgctg
cacaggtttagcgggaagattttgcacatagattttggagattgttttgaagcatcaatg
aatcgtgagaagttcccagagaaggttccgtttcgtttgacaagaatgcttgtgaaagcc
atggaagttagtggtattgaaggaaacttccgctcaacttgtgaaaatgttatgcaagtt
ttgcgaacaaataaagatagtgttatggcaatgatggaggcctttgtgcatgatcctctc
ataaattggcgtcttttcaacttcaatgaagtccctcaaatgtctatgcttaatagcaat
catgtccctcctgttgtaactagtgacgaatctggtgcaaatagggagcttcctcaccct
cagcgtggtgtccgtgaaagggaaattcttcaggctgttaaccaactcggtgatgctaat
gaggtgctaaatgagcgtgctgtggttgtcatggctcgtatgagtaataagcttacagga
cgggatttttcgacttgctcctcagtattaaacacctcccttcagaatgcagttgaccat
aacagcttaggtgcgggagatgctcgtgaaattgatcaagctttatctgtgaaattgcaa
gtacagaaattgatttcccatgctacctcacatgaaaatttgtgtcaaaattatgttggg
tggtgtcctttctggtaa

DBGET integrated database retrieval system