KEGG   Medicago truncatula (barrel medic): MTR_5g005380Help
Entry
MTR_5g005380      CDS       T01716                                 

Definition
(RefSeq) Serine/Threonine-kinase TOR
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MTR_5g005380
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   MTR_5g005380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 2471 aa AA seqDB search
MATTSQSHSHSHSHRYIGPPSVLPGDALNRILADLCTRGNPKEGASLAFKKHLEEEARDL
SGEAFSRFMDQLYDKISSHLESSDVAENLGALRAIDELIDVALGENGSKVSRFSSYMRTV
FEAKRDPEILVHASRVLGHLARAGGAMTADEVERQVKIALDWLEGPRIEYRRFAAVLILK
EMAENASTVFNVHVPEFVDAIWVPLRDPALPVRERAVEALRACLNVIEKRETRWRVQWYY
RMFEATQDGLGKNAPVHSIHGSLLAVGELLRNTGEFMMSRYREVAEIVLRYLEHRDRLVR
LSITSLLPRIAHFLRDRFVTNYLTICMNHILSVLKVPQDRDSGFIALGEMALALDGELSH
YLPTISTHLREAIAPRRSKPSLEALACVGNIAKAMGPTTEPHIRGLLDVMFSAGLSTVLV
ETLEQISMSIPSLMPTIQDRLLDSISMVLSKSPYLGRPAQSIGRGTNIIVVPQVSELSGS
ALIQLALQTLARFNFKGHDLLEFARESVVVYLDDEDRSTRKDAALCCCKLIATSFSGIAS
AHFGSNRLSRSGGKRHRLIEELVEKLLISAVADADVTVRHSIFTSVHGDRGFDEYLAQAD
NLSAVFAALNDEDFDVREYTISVAGRLSEKNPAYVLPALRRYLIQLLTYLGQSADSKCKE
ESAKLIGCLIRNCERLILPYIAPIHKALVARLVDVNANIGIISGVLVTVGDLARVGGFAM
RQYIPELMPLIVEALLDGAAVSKREIAVATLGQVVQSTGYVITPYNEYPQLLGLLLKLLN
GELVWSTRREVLKVLGIMGALDPHLHKRNQKALPGPHGEVTGPACDSSQQIQSIDEFPKD
LWPSFASSDDHYSTVAINSLMRILRDPSLASYHLKVVGSLMFIFKSMGLGCVPYLPKVLP
DLFHTVRTCEDSLKDFITWKLGTLVSIVRQHIRKYLQDLLSLVSEFWSAFSLPAPARPAL
GYPVLHLVEQLCLALNDEFRTYLPVILPRCVQIISDAERCNDYTYVLDILHTLEVFGGTL
DEHMHLLLPALIRLFKVDTSVDIRRAAIKTLTRLIPRVQVTGHISSLVHQLKLVLDGKND
DLRKDAVDALCCLAHALGEDFKIFIPSIHKLLRKYHLRHKEFEEIEGRLQRREPLILGTT
ATQRLNQRLPVEVISDPLHDVEKDPYEAGYDAHKLKGHQVNDSRLRSAGEASQRSTREDW
AEWMRHFSIQLLKESPSPALRTCARLAQLQPFIGRELFAAGFVSCWAQLNEATQRHMVRN
LEMAFSSPHIPPEILATLLNLAEFMEHDEKPLPIDIRLLGALAEKCRAFAKALHYKEMEF
EGARFTKMDANPVSVVEALIHINNQLHQHEAAVGVLTYAQQNLEFQLKESWYEKLQRWDD
ALKAYTAKASQVTSAQLVLETTLGRMRCLAALARWEELSDLCKEYWTPADAVTRLEIAPM
AANAAWNMGEWDQMAEYVSRLDDGDETKLRSAGNNASSSDGSSNGTFFRAVLSVRRGKYD
EAREYVERARKCLATELAALVLESYERAYSNMVRVQQLSELEEVIDYCTLPIGDRVAEER
RALIRNMWTQRIEGAKSNVEVWQALLAVRTLVLPPAEDIETWLNFASLCRKSGRISQARS
TLVKLLQYDPEITPENVQYHGPPQVMLAYLKFQWSLGEDSKRREAFIRLQNLAMEFSSAP
NIQPVTQTVFTSGLNPSVPLLARVYLKLGSWQWSLSPGLVDESIKDILNAFTKATQYANK
WAKAWHKWALFNTAVMSHYTLRGFPDIAAQFVVAAVTGYFHSIACAANSKGVDGSLQDIL
RLLTLWFNHGATAEVQMALTKGFSLVNINTWLVVLPQIIARIHSNNHAVRELIQSLLVRI
GQNHPQALMYPLLVACKSISNLRKAAAQEVVDKVRKHSGVLVDQAQLVSKELIRVAILWH
ELWHEGLEEASRLYFGEHNIEGMLKVLEPLHEMLEEGAMKNNATIKERIFIEAYRQELLE
AYECSMNYRRTGKDAELTQAWDIYYHVFRKIDKQLQSLATLDLETVSPELLECRNLELAV
PGTYRADVPVVTIASFARQLEVIPSKQRPRKLTIHGSDGDDYAFLLKGHEDLRQDERVMQ
LFGLVNTLLENSPKTAEKDLSIERYAVIPLSPNSGLIEWVPNCDTLHQLIREFRDARKVI
LNHEHKCMLSFAPDYDHLPLINKVEVFEHGLSSSEGNDLAKVLWLKSRTSEVWLERRTNY
TRSLAVMSMVGYLLGLGDRHPSNLMLHRFSGKILHIDFGDCFEASMNREKFPEKVPFRLT
RMLVKAMEVSGIEGNFRSTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQM
SMLNSNHVPPVVTSDESGANRELPHPQRGVREREILQAVNQLGDANEVLNERAVVVMARM
SNKLTGRDFSTCSSVLNTSLQNAVDHNSLGAGDAREIDQALSVKLQVQKLISHATSHENL
CQNYVGWCPFW
NT seq 7416 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgtctcagtcgcactctcactcccactcccaccgttatatcggtcctccc
tctgtcctacccggtgatgcactcaatcgtattctcgccgatctctgcactcgcggaaac
cctaaggaaggagcttctttagcttttaagaagcatctagaagaagaagcacgtgactta
agtggtgaagctttttcgcgatttatggatcaattgtatgataagatatcgagtcatttg
gagagtagcgatgttgccgagaatctaggagctcttagggcaattgacgagttaattgat
gtggcgcttggtgaaaatggttctaaggtttctagattctcaagttatatgcggactgtt
tttgaggcgaagcgtgatccggagattttggttcatgcgagtagggttcttggtcatctt
gctagagctggtggagctatgactgctgatgaagttgaacgtcaggttaaaattgcattg
gattggcttgaagggcctagaattgagtatcggcggtttgcagctgttttaatcttgaaa
gaaatggcagaaaatgcttcaactgtttttaatgtccatgtgccggaatttgtcgatgct
atctgggttcctttgagagatccagcattgccagttcgtgagcgggctgtggaggcattg
cgtgcttgccttaatgttattgaaaagcgtgagacacgctggcgtgtgcaatggtattat
cgaatgtttgaggctacacaagatggattaggtaaaaatgctccagtgcacagtatacat
ggctcgttgctcgctgttggagagcttttgaggaatactggtgaattcatgatgtcaaga
taccgagaagttgccgaaattgttcttagatatctagagcaccgggatcggcttgttcgc
ttgagcattacttcgttgctacctcgaattgcacattttctgcgtgatcgttttgtaacc
aactatttaacaatatgcatgaatcatattctttccgtcttgaaagttcctcaagatcgt
gatagtgggttcattgctctcggagagatggctttggcactggatggggaacttagccat
tatttgccgacaatatctactcatttacgcgaggcaattgctccgcgtaggagtaaaccc
tcacttgaggccttggcttgtgttggaaatattgcaaaagcaatggggcctactactgaa
cctcatattcgtggacttctggatgttatgttttctgctggtctttcgactgttcttgtg
gaaactcttgagcaaataagcatgagcattccatctctgatgccaaccattcaagaccgg
ttactcgacagcatatctatggttctctctaaatcaccttatctagggaggcctgcacaa
agcatcggtagaggaacaaatataattgtcgttccacaagtttcagagcttagtggttct
gctcttatacagcttgctttgcagactcttgctcgctttaactttaagggccatgatcta
cttgagtttgccagggaatcagttgttgtctatttggatgatgaggatagatctacacga
aaagatgcagctctatgttgttgcaaattaattgctacttctttctctggtattgcaagt
gcacattttggttctaacaggttgtctcggtccggagggaagcgccatcgtcttattgag
gagcttgtggagaagcttctcatttctgctgttgcagatgctgatgttaccgtacgccac
tctatcttcacttctgttcatggagacagagggtttgatgagtatttggcacaggctgac
aatttgagtgcagtatttgccgctttaaatgatgaggattttgatgttcgggagtacaca
atttctgtggctggaaggttgtcagagaaaaatcctgcatatgttcttccagctcttcgt
cgttatctcatacagttgttgacatacttgggccaaagtgctgatagcaaatgcaaggag
gaaagtgcaaagttaattggctgtttgataaggaattgtgaacgactaatacttccatac
attgctccaattcataaggcactcgtggccagacttgttgatgttaatgccaatattgga
attataagtggagtccttgtaactgtgggggatcttgccagggtgggaggttttgcaatg
aggcaatacattcctgaacttatgcctttaattgttgaagctttattggatggagcagct
gtctccaaacgtgaaatagcagttgctacccttggtcaagttgtacagagcactgggtat
gttattactccatataacgagtatccacaactacttgggttactcttaaaattactgaat
ggtgagctagtgtggtctaccaggcgtgaagtattgaaggttcttggcataatgggtgct
ttggatcctcatttgcataaacgaaatcaaaaagcactgccagggcctcatggagaagtt
acaggccctgcttgtgattcaagccaacagattcagtctattgatgaatttcccaaagac
ttgtggccttcttttgcttcatcagatgaccattattccacggttgcgattaattctctc
atgcgtattttaagggatccgtcacttgctagttaccacttaaaggtcgttgggtctctg
atgttcatattcaagtcaatgggactaggctgcgttccatacttgccaaaggttttgcct
gatctctttcacactgttcgtacatgtgaagatagtttgaaggatttcattacatggaag
cttgggactctggtgtcaattgtgcgccagcacattcgaaaatatttgcaagatttgctc
tctttagtatccgaattttggtccgcattctctcttccagccccagctcgtcctgccctt
ggctatccggtacttcacctggtagaacaactttgcttggctcttaacgatgaatttagg
acatatcttccagttattctgccgagatgcgtacagataatcagtgatgcagaacggtgc
aatgactacacttatgttcttgatattctccacactctagaagtttttggtgggactttg
gatgagcatatgcatctacttcttcctgctcttattcgtttgtttaaagtggatacctca
gttgacataagacgtgctgcaattaaaactttgacacgattgatacctcgtgtgcaggtc
actggtcacatatcctctcttgttcatcagttgaagttagttttggatgggaaaaatgat
gatctccgaaaggatgctgttgatgcactttgttgtttggctcatgcccttggcgaggat
ttcaagatttttataccatcaatacacaaacttcttcggaaatatcacttgcggcacaag
gaatttgaggaaattgaagggcgtctacagagacgtgagccgctaattcttgggacgaca
gctactcaaagactgaaccaacgacttcctgttgaggttattagtgatccactacatgat
gtggagaaagatccttatgaagctggatatgatgctcacaaactcaaaggccatcaggtt
aatgatagtcgattacgatctgctggtgaggcttctcagcgaagtacaagggaagattgg
gcagaatggatgaggcattttagcattcaacttttaaaggaatctccttctccagcctta
cgaacctgtgctaggcttgcacagttgcagccttttattgggagagaattgtttgcagct
ggatttgtcagctgttgggcacagctcaacgaggctactcagagacatatggttcggaat
ctagagatggcattttcatctccacatattcctccggaaattttggcaactctactcaat
ttggctgagttcatggaacatgatgagaaacctcttcctattgacattcgtcttcttggt
gcacttgcagaaaagtgtcgtgcatttgcaaaagccttgcactataaagaaatggaattt
gaaggagctcggtttaccaagatggatgctaacccagtttctgtagttgaagctcttatt
catataaacaaccaattgcaccaacacgaggctgcagttggagtattgacctatgctcaa
cagaatctagaatttcaactcaaggagtcatggtatgagaaactgcagcgatgggatgat
gctctcaaggcatatactgcaaaggcgtctcaagtaacaagtgcacaacttgtgttggaa
accactttaggtaggatgagatgccttgctgcattagctcgatgggaagagttaagtgat
ctatgtaaggaatattggacccctgctgatgcagtaactcgtcttgaaatagcaccaatg
gctgctaatgctgcttggaacatgggagaatgggaccaaatggcagaatatgtgtctcgg
ttagatgatggcgatgaaacaaaacttcgaagcgcgggaaataatgcttctagtagtgat
ggaagtagtaatggtaccttcttcagggctgttctatcagttcgcagaggaaagtatgat
gaagcacgtgagtatgttgaaagagctagaaaatgtctggcaacagagcttgctgctttg
gttttggagagctatgagcgtgcttacagcaatatggttcgtgttcagcaactatctgaa
ctagaagaggtgattgattactgtacacttcctattggagatagagttgctgaagagcga
cgggctcttattcgcaacatgtggactcagcgtatagaaggagcaaagagcaatgttgag
gtttggcaggcacttttggctgttagaacacttgtgctgccaccagctgaagacattgaa
acatggctcaattttgcttctctttgcagaaaaagtgggcgcattagccaagcaagatct
actttagttaaacttctacagtatgaccctgagataactcccgaaaatgtccaatatcat
ggcccacctcaagtaatgctggcgtacttaaagttccaatggtcacttggagaggattca
aagcgtagagaagcatttattaggctacagaatttggctatggaattttcaagtgcaccc
aacattcagccagttacacaaacggttttcacaagtggtttgaatccaagtgttcctctc
cttgctcgtgtttatctgaaacttggctcctggcagtggtcactttcccctggactagtt
gatgagtccataaaagatatactcaatgcattcacaaaagctactcagtatgcaaataaa
tgggccaaagcttggcataaatgggcattgttcaatacagcagtgatgtctcattacact
ttaagaggtttccctgacattgcagcacagtttgttgttgctgctgtcacgggatacttt
cattctatagcatgtgcagcaaattcgaaaggtgttgacgggagtttacaggatattctt
cgacttttgacactatggttcaaccatggagctactgcagaagttcaaatggccctaacg
aaaggattttcccttgttaatatcaatacgtggctagtagttctgccccaaatcattgcc
aggatacactctaataaccatgccgtgagagagttgatacaatcacttttggttcgaatt
gggcaaaatcatccacaggctctcatgtatcctttgctcgtggcctgtaaatcaataagc
aacttgcgcaaagctgcagctcaggaagttgtggacaaagttcggaagcatagtggtgtg
cttgtggatcaggcccaacttgtatcaaaagaacttatcagagttgctattctttggcac
gaactatggcatgaaggactggaagaagccagccgtctttatttcggcgaacataatatc
gaagggatgctaaaggtcttggagccattgcatgaaatgcttgaagaaggtgcaatgaaa
aacaatgctaccataaaggagagaatttttattgaggcctatcgacaggaattattagag
gcttacgaatgctctatgaattataggagaactgggaaagatgccgagcttactcaggca
tgggatatctattatcatgtgttcagaaagatagataagcaacttcaaagtcttgctact
ttagacttggagacggtttctccagaattgctagaatgccgaaatttagagcttgctgtt
cctgggacataccgcgctgatgtcccagtggttactattgcatcatttgcacgccagctt
gaagtcataccatctaagcaacgacccaggaaattaactattcatgggagtgatggtgat
gattatgcctttttattgaaggggcacgaggatttacgccaggatgaacgagttatgcag
ctttttggtttggtgaatactctgcttgagaattctcctaaaacagctgagaaagatctc
tctattgaacgatacgctgtaatcccgttatctccaaacagtggtttaattgaatgggtc
ccgaattgtgacactttacatcaacttatccgggagttcagagatgctagaaaggtcatc
ttgaatcatgaacacaaatgcatgctcagttttgcacctgattatgatcatttgcctctt
ataaataaagtggaggtgtttgaacatggtttgagcagttctgaaggaaatgacctagca
aaagtgctttggttgaaaagtcgaacttctgaggtatggctcgagaggaggacaaattac
accagaagtttggcagttatgagcatggttggctatcttcttgggttgggtgatcgccat
cctagcaatcttatgctgcacaggtttagcgggaagattttgcacatagattttggagat
tgttttgaagcatcaatgaatcgtgagaagttcccagagaaggttccgtttcgtttgaca
agaatgcttgtgaaagccatggaagttagtggtattgaaggaaacttccgctcaacttgt
gaaaatgttatgcaagttttgcgaacaaataaagatagtgttatggcaatgatggaggcc
tttgtgcatgatcctctcataaattggcgtcttttcaacttcaatgaagtccctcaaatg
tctatgcttaatagcaatcatgtccctcctgttgtaactagtgacgaatctggtgcaaat
agggagcttcctcaccctcagcgtggtgtccgtgaaagggaaattcttcaggctgttaac
caactcggtgatgctaatgaggtgctaaatgagcgtgctgtggttgtcatggctcgtatg
agtaataagcttacaggacgggatttttcgacttgctcctcagtattaaacacctccctt
cagaatgcagttgaccataacagcttaggtgcgggagatgctcgtgaaattgatcaagct
ttatctgtgaaattgcaagtacagaaattgatttcccatgctacctcacatgaaaatttg
tgtcaaaattatgttgggtggtgtcctttctggtaa

DBGET integrated database retrieval system