KEGG   Medicago truncatula (barrel medic): MTR_5g008460Help
Entry
MTR_5g008460      CDS       T01716                                 

Definition
Cytochrome c
Orthology
K08738  
cytochrome c
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MTR_5g008460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 113 aa AA seqDB search
MASFELAPPGDAKSGDKIFRTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAA
NKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATAQ
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttgaactagcacctcccggtgatgccaaatccggagataaaatctttcga
accaaatgcgctcagtgccacactgtcgataagggcgctggtcacaaacaaggacccaat
ctgaatggtttgtttggaaggcaatcaggcactactcccggatattcctactcagcagct
aacaagaacatggctgtgaattgggaggagaagactttatatgattatttgcttaacccc
aaaaagtatattccagggaccaagatggtatttcccggtctaaagaaaccccaagaacgc
gctgatcttattgcatatctgaaggaagccactgcacagtga

DBGET integrated database retrieval system