KEGG   Medicago truncatula (barrel medic): MTR_5g009070Help
Entry
MTR_5g009070      CDS       T01716                                 

Definition
Magnesium-chelatase subunit chlD
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTR_5g009070
Enzymes [BR:mtr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MTR_5g009070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 754 aa AA seqDB search
MGFSLTQTPHTNLQLQFHSLFSSKPFLSLKFHQTCRVQPKRSVPKLRAQSENGAAVLTSE
EEKKLDASNYGRQYFPLAAVVGQDAIKTALLLGATDPRIGGIAISGRRGTAKTIMARGMH
AILPPIEVVEGSIANSDPSCPEEWEDDLAQRVEYDSDGNIKTRIVKSPFVQIPLGVTEDR
LIGSVDVEESVKTGTTVYQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLTEGVNIVER
EGISFRHPCRPLLIATYNPDEGSVREHLLDRIAINLSADLPMSFENRVAAVGIATEFQDN
CGEVFKTVDEDTDNAKTQIILAREYLKDVTIGKEQLKYLVLEALRGGVQGHRAELYAARV
AKCLAALEGREKVYADDLKKAVELVILPRSIVTDNPPEQQNQPPPPPPPPQNQESNEEQN
EEEDKEEEEEEEDDKDEEKEEQQEQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRA
KNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKDTENRRKVFVEKTDMR
AKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDSAEV
LLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGRIMIVAITDGRAN
ISLKRSTDPEAAAATDAPKPTSQELKDEILEVAGKIYKSGMSLLVIDTENKFVSTGFAKE
IARVAQGKYYYLPNASDAVVSMATREALSALKSS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcagtttaacacaaacccctcacaccaatcttcaactccaattccactctcta
ttttcttcaaaaccatttctctctttgaaatttcatcaaacatgtcgagttcaaccaaaa
cgcagcgttccgaagcttcgcgctcaatctgaaaatggtgctgcggtccttacttctgag
gaggagaagaagctcgatgctagtaattatggaagacagtacttccctcttgctgctgtt
gttggccaagatgctattaaaactgctcttttacttggggctactgaccctaggattgga
gggattgctatatcaggaaggcgtggaactgctaaaaccataatggcacgtggaatgcac
gcaatacttccgcctattgaagtagtagaaggttccatagccaattcagatccgtcgtgc
ccagaagagtgggaagatgatcttgcccaacgcgtggaatatgattctgatggaaatatt
aaaactcgtattgtcaaatctccctttgttcagattcctcttggagtcacagaggacaga
ctcattggatcagttgatgttgaagagtctgtgaagactggcacaactgtttaccaacca
ggcctacttgctgaagctcatagaggtgttctatatgttgatgaaattaatcttttggat
gagggtatcagtaatttgctccttaatgtattgactgaaggagtaaatattgttgaaaga
gagggaatcagctttaggcacccctgcaggccccttctgattgctacctataaccctgac
gagggttctgttcgtgaacatctgctagatcgcattgcaattaatttgagtgcagatctt
ccaatgagttttgaaaaccgtgttgcagctgttggaattgcgacagaatttcaggataac
tgtggcgaagtatttaaaacggttgatgaggatacagacaatgcaaagacacagatcatc
ttggctagagagtatctcaaggatgttactattggcaaagaacaattaaaatacctggtt
cttgaggctttacgaggtggtgtccagggacacagagctgagctgtatgctgctcgtgtt
gctaagtgcttagctgctctggagggacgtgaaaaggtttacgcggatgaccttaaaaaa
gccgtagaattggtcattctcccccggtcaattgttactgataatccacctgagcaacaa
aatcagccacctccgcctccaccgcctccacaaaaccaagaatccaatgaagaacagaat
gaagaagaagacaaagaggaagaagaagaggaggaggatgacaaggatgaagagaaggaa
gaacagcaagaacaattacctgaagaatttatctttgatgctgaagggggcttggtggat
gaaaaacttctcttctttgcccaacaagcacagaggcgccgtgggaaggctggaagggca
aaaaatgttatattttcggaggacagaggccgatatatcaagccaatgcttccaaagggt
cctgtaaagagattagcagttgatgcaacccttagagctgctgcaccttatcaaaagttg
cgaagggaaaaagacactgaaaaccgtagaaaagtatttgttgaaaaaactgacatgagg
gcaaagagaatggcacgtaaagcaggagcattggtgatatttgtggttgatgccagtgga
agcatggcattgaacaggatgcagaatgcaaaaggtgcagcacttaagcttctggcagaa
agttatacaagcagggatcaggtatcaataattcctttccgtggagattcagctgaagtt
cttctgccaccttctagatcgattgcaatggctaggaaacgtcttgaaaggcttccgtgt
ggtggagggtcaccccttgcccatggtcttaccacggctgttagggttggattaaatgca
gagaaaagtggcgatgttggacgtataatgattgttgcaatcactgatggccgagccaac
atatctttaaaaaggtcaactgaccctgaagctgctgccgctactgatgcccctaaacct
acatcacaagaattgaaggatgaaattcttgaagtggctgggaagatatataaatcagga
atgtctctccttgtcatcgacactgaaaacaagtttgtctcgacaggtttcgcgaaggag
attgctagagttgctcaagggaagtattattatttgccaaatgcttcggatgctgttgtc
tcgatggcaacaagggaagcattatcagctttgaagagctcataa

DBGET integrated database retrieval system