KEGG   Medicago truncatula (barrel medic): MTR_5g009670Help
Entry
MTR_5g009670      CDS       T01716                                 

Definition
Apospory-associated protein C
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_5g009670
Enzymes [BR:mtr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     MTR_5g009670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 304 aa AA seqDB search
MNHSGAESDHKITSVEVIKDKNGIEQVVLRNVRGASATVSLHGGQVLSWKTERGEELLFT
STKAVYTPPKPVRGGIPICFPQFGNRGTLEQHGFARNKIWVIDQNPPPLPTDSNGKACID
LLLKPSEDDMKIWPHSFEFRLRVCLAADGRLNMISRIRNVNGKPFSFSFAFHTYFSISDI
SEVRVEGLETLDYLDNLHQKERFTEQGDALTFESEVDRVYLDSSSMVAVLDHERKRTFVI
RKEGLPDVVVWNPWEKKSKSIVDFGDEEYKQMLCVDGAAVGKPITLKPGEEWTGRLELSV
VPST
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattctggagctgaaagtgatcataaaataacatcagttgaagttatcaaggac
aaaaatggaatagaacaagttgttcttcgaaacgttcgaggagcttcagcaacggttagc
ttgcatggagggcaagttctttcatggaaaacagaacgcggtgaagagttattgttcact
agtaccaaggccgtctacactcctccaaaaccagtacgaggaggaattccaatctgtttt
ccacagtttggaaaccgtggaacactagagcaacatggatttgcaaggaataagatatgg
gttattgatcaaaatcctccaccgctgcccacagattcaaatggaaaagcttgcatcgac
ttgctgctcaaaccatctgaagacgatatgaagatatggccacatagcttcgagtttcgc
ctaagggtctgtttggcagcagatggccgtctgaatatgatatctcgcatccggaatgtc
aatggcaagcctttcagtttctcctttgcatttcatacatatttctcgatatccgatatc
agcgaagtgagggtagaagggttggaaactcttgactatctggataacctacaccagaag
gaacgcttcactgaacaaggagatgctttaacatttgaatctgaggtggatcgagtttat
ctcgattctagcagtatggtagccgttctagatcacgagaggaagcgaacatttgtgata
cgaaaggaaggtcttccagatgttgttgtttggaatccctgggagaaaaaatcaaagtca
atagtggattttggggatgaagagtacaagcaaatgctctgcgtggatggtgcagcagtt
ggaaagccaataaccttgaagccgggagaagaatggaccggccgtttggagctctccgtt
gttccttctacatga

  All links  
No link information was found.   
DBGET integrated database retrieval system