KEGG   Medicago truncatula (barrel medic): MTR_5g010340Help
Entry
MTR_5g010340      CDS       T01716                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00480  Glutathione metabolism
mtr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MTR_5g010340
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MTR_5g010340
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MTR_5g010340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 11436241
NCBI-ProteinID: XP_003611097
UniProt: G7KC39
Position
5
AA seq 195 aa AA seqDB search
MTPETIGEQKSVFDFYVKDAKGGIANLATYKGKVLLIVNVASQCGLTDSNYAELNQLYDK
YKDQGFEILAFPCNQFRDQEPETSDKIVEYVCTRFGSKFPIFGKIKVNGFHSAPLYKFLK
SGKFGVIFGDDIQWNFAKFLIDKDGQVAARYYPTTSPLSLEVNTMLFLGFTFMIFVSYFV
TASYFVLSKGKGSTR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgacccctgaaacaatcggtgaacaaaaatctgtgtttgatttttatgtcaaggatgct
aagggaggtattgctaatctcgcaacttataagggaaaagttctgctgattgtcaatgtt
gcttctcaatgcggcttaaccgactccaactatgctgagttgaatcaactatatgacaag
tataaagaccaaggcttcgagattttggcatttccatgtaatcaatttcgcgaccaagag
cccgaaactagtgataaaattgtggagtatgtttgcactcgcttcggatcaaaatttccc
atctttggtaagattaaagtgaatgggttccattctgctcctctgtataaattcttgaag
tcagggaaatttggagtaatttttggagatgacattcagtggaactttgctaagtttttg
attgataaggatggccaagttgccgctcgctattatcctaccacttctcctcttagcctt
gaggtaaacacaatgttatttttaggtttcactttcatgatatttgtcagctactttgtg
acggcaagctactttgtgttgagtaaaggcaaaggttcgactcggtaa

DBGET integrated database retrieval system