KEGG   Medicago truncatula (barrel medic): MTR_5g011250Help
Entry
MTR_5g011250      CDS       T01716                                 

Definition
Leucoanthocyanidin dioxygenase
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    MTR_5g011250
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     MTR_5g011250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 356 aa AA seqDB search
MGTVAQRVESLALSGISSIPKEYVRPKEELANIGNIFDEEKKEGPQVPTIDLKEINSSDE
IVRGKCREKLKKAAEEWGVMHLVNHGISDDLINRLKKAGETFFELPVEEKEKYANDQSSG
KIQGYGSKLANNASGQLEWEDYFFHCIFPEDKRDLSIWPKTPADYTKVTSEYAKELRVLA
SKIMEVLSLELGLEGGRLEKEAGGMEELLLQMKINYYPICPQPELALGVEAHTDVSSLTF
LLHNMVPGLQLFYEGKWVTAKCVPDSILMHIGDTIEILSNGKYKSILHRGLVNKEKVRIS
WAVFCEPPKEKIILKPLPELVTEKEPARFPPRTFAQHIHHKLFRKDEEEKKDDPKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggaacggtggctcaaagagttgaaagcttagccttgagtggtatatcatcaatccca
aaagaatatgtgagaccaaaagaagagttagcaaacataggtaacatctttgatgaagaa
aaaaaagaaggtcctcaagttccaacaatagacctaaaagaaataaactcttcagatgaa
atagttagaggaaaatgtagagagaagcttaagaaagctgcagaagaatggggtgtgatg
catttagtgaaccatggtatatctgatgatcttattaatcgtttgaagaaagctggtgaa
acattttttgagcttcctgttgaagaaaaagagaaatatgcaaatgatcaaagttctggg
aagattcaaggttatggaagtaaattagctaataatgctagtggtcaacttgaatgggaa
gattatttctttcattgcatttttccagaggataaacgtgatttgtctatatggcccaag
acacctgctgattatactaaggttacaagcgaatatgcaaaggaattaagagtcctagct
agcaagataatggaagtgttatctcttgaactagggttggaaggtggaaggttagaaaaa
gaagctggtggaatggaagagcttttacttcaaatgaaaattaattactacccaatttgc
cctcaaccagagctagcacttggagttgaagcccatacagatgtaagttcacttactttc
ctcctccataatatggtgccaggtttgcaacttttctatgagggcaaatgggtcactgca
aaatgtgtacctgattcaattctcatgcatattggtgacacaattgagatacttagcaat
ggaaagtacaaaagtatccttcatcgtggattggtgaataaggaaaaagttagaatatct
tgggcagtgttttgtgaaccacctaaggagaaaattattctgaagccacttcctgaactt
gtaactgaaaaagaaccagcaaggtttccacctcgcacttttgctcagcatattcatcac
aaactttttaggaaggatgaggaggagaagaaagatgatcccaaaaaatga

DBGET integrated database retrieval system