KEGG   Medicago truncatula (barrel medic): MTR_5g013020Help
Entry
MTR_5g013020      CDS       T01716                                 

Definition
Palmitoyl-protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MTR_5g013020
  Lipid metabolism
   00062 Fatty acid elongation
    MTR_5g013020
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     MTR_5g013020
Lipid biosynthesis proteins [BR:mtr01004]
 Fatty acid synthase
  Component type
   MTR_5g013020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 327 aa AA seqDB search
MMLLLRLPPLSFLFIFFFFFFFPISHSIPFIVLHGIGDQCSNRGVKSFTQELITYSGVKG
FCVEVGNGSWDSWFMPLKEQTDVVCQKVKKMKELKGGYNIVGLSQGNLIGRGVVEFCEGG
PPVKNFISLAGPHAGTASVPLCGTGIFCVLADNLIKGEVYSNYIQEHLAPSGYLKLPNAI
PKYLENCRYLPKLNNEKPGQRNSTYKERFSSLENLVLIMFEQDTVLIPRETSWFGYYPDG
FFKPVLPPQETKLYTEDWIGLKTLDEAGRVHFISVPGKHLGISEADMKKHVVPYLNGKTS
RNDSTTKAGFRRMRGFNQRFIHINKME
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttctacttcgtcttcctcccttgtcctttctcttcatcttcttcttcttcttc
ttcttccccatttcacactcaattcccttcattgtccttcacggaattggagatcagtgt
tctaaccgtggagtcaaatcattcacacaagaattgatcacatactctggtgttaaggga
ttctgcgtagaggtaggcaatggatcatgggattcatggtttatgcctttgaaagaacag
acagatgttgtttgccagaaggtgaagaaaatgaaagagttgaagggaggatacaacatt
gttggcctctcccagggaaatttaattggtcgaggtgtggtcgagttttgtgaaggagga
cctcccgttaagaacttcatctctttagcaggccctcatgctggtactgcttcggttccc
ctctgtggtacaggtatcttttgtgtccttgcagacaatctcatcaagggagaggtgtac
agtaactatattcaagaacacttggctcctagcggatatctaaaattaccaaatgccata
cctaaatatttggagaactgtaggtacctccctaagcttaataatgaaaaacccggtcag
aggaattccacttacaaggaaagattcagtagcttagagaatttggtacttatcatgttt
gagcaagacacagttttaataccgagagaaacatcctggtttggttattatccagatggc
ttcttcaagccagttctaccaccacaagagacaaaactctacactgaagactggattggc
ttaaaaactttagacgaagctggccgtgtccatttcattagcgttcctggaaagcatcta
gggatatccgaggcggatatgaagaaacatgtagtgccatatttgaacggcaaaacgtca
agaaatgatagcaccactaaggctggctttcggaggatgcgtggatttaatcaaagattt
attcatatcaacaagatggagtaa

DBGET integrated database retrieval system