KEGG   Medicago truncatula (barrel medic): MTR_5g013560Help
Entry
MTR_5g013560      CDS       T01716                                 

Definition
Calcineurin B-like protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     MTR_5g013560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 202 aa AA seqDB search
MGCYHSRGRIFPEEEDPIILASETAFGVNDIEALFELFKSISGSVINDGLISKEEFQLAI
FNNKTKENLFTSRVFVLFDVKRKGVIDFGDFVRALNVFHPNAPQEVKIDCFIERDDVKQM
IDALLCEFEIKLSDDMIETIIQKTLLDADPNQDGKIDKFEWKNFVSQNPSLLKIMTLPYL
RDITTIFPSFVFNSKVDDDIAT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggttgttaccactctagaggaagaatatttccagaggaggaggacccaataattctt
gcatcagaaacagccttcggtgttaatgacattgaagcattatttgagctttttaagagc
atcagtgggtcggtcattaatgatggactaataagcaaggaagaatttcaattggcgatt
ttcaataataaaacaaaggagaatctcttcacaagtcgggtctttgttctatttgatgtg
aagagaaagggagtaattgactttggggactttgtgagagcactgaatgtcttccaccct
aatgcaccacaagaagtcaagatagattgttttatagagcgcgatgatgtgaaacaaatg
atagatgcgcttctatgtgaatttgaaattaagttgagtgatgacatgatcgaaacaatt
attcagaagactctcttggatgctgatccaaaccaagacgggaagatagacaaattcgag
tggaaaaattttgtttctcaaaatccgtcattgttgaaaatcatgaccctaccatatcta
agggatattacaacaatttttcccagttttgtatttaactcaaaggtggatgatgacatt
gctacttga

DBGET integrated database retrieval system