KEGG   Medicago truncatula (barrel medic): MTR_5g016870Help
Entry
MTR_5g016870      CDS       T01716                                 

Definition
(RefSeq) histone-lysine N-methyltransferase
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MTR_5g016870
Chromosome [BR:mtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MTR_5g016870
   Polycomb group proteins
    PRC2-EZH2 complex
     MTR_5g016870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 863 aa AA seqDB search
MASSSPPPPSPSSSSRSDPPLDPSTKKAEETSPAVKDVLAVIESLKKQVAAKRIVTVKTR
VEENRQKLIATTNQLWKSSAERTCGIADTDRGLDLLSKRQKEAIDMHNGIRAGNDDGESN
GYNGDDHGSTAVLLGSNYAVKNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVLGRR
RIYYDQNGGEALICSDSEEELIDEEEEKREFVESEDFILRMTIREFGLSDVVLEILAQCF
SRKTSDIKVRYETFCNEDNSGEDSKNGDAQDNSQIDDSFLEKDLEAALDSFDNLFCRRCR
VFDCRLHGCSQDLVFPAERQPSWTPPNTEDVPCGPNCFRTVLKAEKMAKVTSTQTDVEDK
SSGGALSRKKSSGRRRIKCSQSESASSNARNISESSDSENGPGRDAASGSHSAPPKTKPV
GKSGIGKRNSKRVAERVLVCMQKRQKKTVASDSDSISEAPDRSLNDMVSDPHVMSGEDNT
RKEEFVDENISKQELADNKSWKTLEKGLLEKGMEIFGKNSCLIARNLLNGLKTCWDVFQY
INCEEGKLSGSTGDATNSLVEGYSKGNNEVRRRSKFLRRRGRVRRLKYTWKSAAYHSIRK
RITERKDQPCRQYNPCGCQSACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCR
SRQCPCFAADRECDPDVCRNCWVSSCGDGTLGIPSQRGDNYECRNMKLLLKQQQKVLLGR
SDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAY
RKGDKLKFANHSPVPNCYAKVIMVDGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAR
KPDAPGLKKEDGAPSSGRAKKLA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagctctccgcctccgccttccccttcttcttcttccagatccgaccctccg
ctcgatccttccacaaagaaagcggaggaaacaagtcctgcagttaaagacgtgttagcg
gttattgaatctttgaagaaacaagttgctgcaaaacgaattgttacggtcaagactaga
gtggaagaaaatagacagaaactgattgctacaactaaccagctatggaaatcgtcggcg
gagaggacatgcggcattgccgatacagatagaggtctggatttgctgagtaagaggcaa
aaagaagcaattgatatgcataatggtattcgtgccggtaatgatgatggtgagagcaat
ggttataatggagatgaccatggttctacggcagttcttctaggatctaattatgctgta
aagaatgctgttcggcctattaaattacctgaagtaaaaagattgcctccttacactacg
tggatttttctggacagaaatcaaagaatgacagaggatcaatcagtattaggtcggagg
cgtatttattatgatcaaaatggtggtgaagcacttatttgcagcgacagtgaggaggaa
ctaattgacgaagaagaggaaaaaagagaattcgtagaatcagaagattttatacttcgc
atgactatcagagaatttggtttatctgatgttgttttggagatcctggctcagtgcttt
tctagaaaaactagtgacattaaggtcagatatgaaactttttgcaatgaagacaatagt
ggcgaggattctaaaaatggagatgcacaagataattcccaaattgacgattcttttctg
gaaaaggatcttgaagcggctcttgactcttttgacaacctattttgtcgccgatgtcgt
gttttcgattgcagattacatggatgctctcaggatcttgtcttcccggctgagaggcaa
ccttcgtggactcctcctaacactgaagatgtaccatgtgggccaaattgtttccgaacg
gtacttaaggcagaaaaaatggccaaagtcacatctactcagactgatgttgaagacaaa
tcctctggtggtgctctatctaggaaaaaatcttctggtagaaggcgtataaaatgcagc
caaagtgaaagtgcttcatctaatgctaggaacatatctgagagtagtgactcggagaat
ggtcctggacgggatgctgcttcaggctcccactcagccccacctaaaactaaaccagtg
gggaaaagtggaatcggtaagagaaacagtaagcgagtggcagaacgcgttctagtttgc
atgcagaaacggcagaagaaaacagtagcttctgattctgattccattagtgaagctcct
gaccgctcattgaatgatatggtttctgacccacatgttatgagtggggaagacaacacg
aggaaagaagaatttgtggatgaaaacatttcaaaacaagaattggctgataataaatct
tggaaaactcttgaaaaagggcttttagaaaaaggaatggagatttttggcaaaaacagc
tgcctaatagccaggaatctcttaaatggtctaaagacatgttgggatgttttccagtac
ataaattgtgaagaagggaagttgtctggttctactggggatgctacaaattctctcgtg
gaaggctattccaagggtaataatgaagtgagaagaaggtcaaaatttttacgtagaaga
ggaagagtccgtcgtttaaagtatacctggaaatctgctgcgtatcattcaatcaggaaa
aggattacagagagaaaggatcagccctgccgacagtacaatccatgtggatgccaatca
gcttgtggaaaggagtgtccttgtcttctaaatggaacctgctgtgagaagtactgtgga
tgccccaagagttgtaaaaatcgatttcgaggctgtcattgtgcgaagagtcaatgccga
agtcgtcaatgtccatgctttgctgcagatagggaatgtgatccagatgtttgtaggaac
tgttgggtcagcagctgtggtgatggcactcttgggattcctagtcaaagaggggataat
tatgaatgtagaaacatgaagcttcttctcaaacagcagcaaaaggttcttcttggacgg
tctgatgtgtctggctggggagccttcttaaagaatagcgttggtaagcatgaatacctt
ggagagtataccggagagttgatttctcaccgggaagcagataagcgagggaagatatat
gaccgtgaaaattcatcttttctctttaatctgaatgatcagtttgttcttgatgcttat
cgaaagggtgataaattgaagtttgcaaaccactctcctgttccaaattgttacgcgaag
gttattatggttgatggagatcatagggtaggaatatttgctaaggaacgaattaatgct
ggtgaggagctgttttatgattaccgttacgagcccgatagagctcctgcttgggctcga
aagccagatgcccctggattgaaaaaagaagacggtgctccttcaagtggtcgtgcaaag
aagcttgcttaa

DBGET integrated database retrieval system