KEGG   Medicago truncatula (barrel medic): MTR_5g016870Help
Entry
MTR_5g016870      CDS       T01716                                 

Definition
Histone-lysine N-methyltransferase CLF
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MTR_5g016870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 870 aa AA seqDB search
MASSSPPPPSPSSSSRSDPPLDPSTKKAEETSPAVKDVLAVIESLKKQVAAKRIVTVKTR
VEENRQKLIATTNQLWKSSAERTCGIADTDRGLDLLSKRQKEAIDMHNGIRAGNDDGESN
GYNGDDHGSTAVLLGSNYAVKNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVLGRR
RIYYDQNGGEALICSDSEEELIDEEEEKREFVESEDFILRMTIREFGLSDVVLEILAQCF
SRKTSDIKVRYETFCNEDNSGEDSKNGDAQDNSQIDDSFLEKDLEAALDSFDNLFCRRCR
VFDCRLHGCSQDLVFPAERQPSWTPPNTEDVPCGPNCFRTVLKAEKMAKVTSTQTDVEDK
SSGGALSRKKSSGRRRIKCSQSESASSNARNISESSDSENGPGRDAASGSHSAPPKTKPV
GKSGIGKRNSKRVAERVLVCMQKRQKKTVASDSDSISEAPDRSLNDMVSDPHVMSGEDNT
RKEEFVDENISKQELADNKSWKTLEKGLLEKGMEIFGKNSCLIARNLLNGLKTCWDVFQY
INCEEGKLSGSTGDATNSLVEGYSKFWSNEYKGNNEVRRRSKFLRRRGRVRRLKYTWKSA
AYHSIRKRITERKDQPCRQYNPCGCQSACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCH
CAKSQCRSRQCPCFAADRECDPDVCRNCWVSSCGDGTLGIPSQRGDNYECRNMKLLLKQQ
QKVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLND
QFVLDAYRKGDKLKFANHSPVPNCYAKVIMVDGDHRVGIFAKERINAGEELFYDYRYEPD
RAPAWARKPDAPGLKKEDGAPSSGRAKKLA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagctctccgcctccgccttccccttcttcttcttccagatccgaccctccg
ctcgatccttccacaaagaaagcggaggaaacaagtcctgcagttaaagacgtgttagcg
gttattgaatctttgaagaaacaagttgctgcaaaacgaattgttacggtcaagactaga
gtggaagaaaatagacagaaactgattgctacaactaaccagctatggaaatcgtcggcg
gagaggacatgcggcattgccgatacagatagaggtctggatttgctgagtaagaggcaa
aaagaagcaattgatatgcataatggtattcgtgccggtaatgatgatggtgagagcaat
ggttataatggagatgaccatggttctacggcagttcttctaggatctaattatgctgta
aagaatgctgttcggcctattaaattacctgaagtaaaaagattgcctccttacactacg
tggatttttctggacagaaatcaaagaatgacagaggatcaatcagtattaggtcggagg
cgtatttattatgatcaaaatggtggtgaagcacttatttgcagcgacagtgaggaggaa
ctaattgacgaagaagaggaaaaaagagaattcgtagaatcagaagattttatacttcgc
atgactatcagagaatttggtttatctgatgttgttttggagatcctggctcagtgcttt
tctagaaaaactagtgacattaaggtcagatatgaaactttttgcaatgaagacaatagt
ggcgaggattctaaaaatggagatgcacaagataattcccaaattgacgattcttttctg
gaaaaggatcttgaagcggctcttgactcttttgacaacctattttgtcgccgatgtcgt
gttttcgattgcagattacatggatgctctcaggatcttgtcttcccggctgagaggcaa
ccttcgtggactcctcctaacactgaagatgtaccatgtgggccaaattgtttccgaacg
gtacttaaggcagaaaaaatggccaaagtcacatctactcagactgatgttgaagacaaa
tcctctggtggtgctctatctaggaaaaaatcttctggtagaaggcgtataaaatgcagc
caaagtgaaagtgcttcatctaatgctaggaacatatctgagagtagtgactcggagaat
ggtcctggacgggatgctgcttcaggctcccactcagccccacctaaaactaaaccagtg
gggaaaagtggaatcggtaagagaaacagtaagcgagtggcagaacgcgttctagtttgc
atgcagaaacggcagaagaaaacagtagcttctgattctgattccattagtgaagctcct
gaccgctcattgaatgatatggtttctgacccacatgttatgagtggggaagacaacacg
aggaaagaagaatttgtggatgaaaacatttcaaaacaagaattggctgataataaatct
tggaaaactcttgaaaaagggcttttagaaaaaggaatggagatttttggcaaaaacagc
tgcctaatagccaggaatctcttaaatggtctaaagacatgttgggatgttttccagtac
ataaattgtgaagaagggaagttgtctggttctactggggatgctacaaattctctcgtg
gaaggctattccaagttttggtcaaatgaatataagggtaataatgaagtgagaagaagg
tcaaaatttttacgtagaagaggaagagtccgtcgtttaaagtatacctggaaatctgct
gcgtatcattcaatcaggaaaaggattacagagagaaaggatcagccctgccgacagtac
aatccatgtggatgccaatcagcttgtggaaaggagtgtccttgtcttctaaatggaacc
tgctgtgagaagtactgtggatgccccaagagttgtaaaaatcgatttcgaggctgtcat
tgtgcgaagagtcaatgccgaagtcgtcaatgtccatgctttgctgcagatagggaatgt
gatccagatgtttgtaggaactgttgggtcagcagctgtggtgatggcactcttgggatt
cctagtcaaagaggggataattatgaatgtagaaacatgaagcttcttctcaaacagcag
caaaaggttcttcttggacggtctgatgtgtctggctggggagccttcttaaagaatagc
gttggtaagcatgaataccttggagagtataccggagagttgatttctcaccgggaagca
gataagcgagggaagatatatgaccgtgaaaattcatcttttctctttaatctgaatgat
cagtttgttcttgatgcttatcgaaagggtgataaattgaagtttgcaaaccactctcct
gttccaaattgttacgcgaaggttattatggttgatggagatcatagggtaggaatattt
gctaaggaacgaattaatgctggtgaggagctgttttatgattaccgttacgagcccgat
agagctcctgcttgggctcgaaagccagatgcccctggattgaaaaaagaagacggtgct
ccttcaagtggtcgtgcaaagaagcttgcttaa

DBGET integrated database retrieval system